solution structure of tandem UBA of USP13
DIDESSVMQL AEMGFPLEAC RKAVYFTGNM GAEVAFNWII VHMEEPDFAE PLTMPGYGGA ASAGASVFGA SGLDNQPPEE IVAIITSMGF QRNQAIQALR ATNNNLERAL DWIFSHPEFE EDSDFV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 77.6 % (1094 of 1410) | 81.6 % (591 of 724) | 69.4 % (384 of 553) | 89.5 % (119 of 133) |
Backbone | 84.8 % (629 of 742) | 96.1 % (245 of 255) | 72.0 % (265 of 368) | 100.0 % (119 of 119) |
Sidechain | 74.1 % (581 of 784) | 73.8 % (346 of 469) | 78.1 % (235 of 301) | 0.0 % (0 of 14) |
Aromatic | 14.5 % (20 of 138) | 17.4 % (12 of 69) | 11.9 % (8 of 67) | 0.0 % (0 of 2) |
Methyl | 98.4 % (126 of 128) | 98.4 % (63 of 64) | 98.4 % (63 of 64) |
1. tandem UBA of USP13
DIDESSVMQL AEMGFPLEAC RKAVYFTGNM GAEVAFNWII VHMEEPDFAE PLTMPGYGGA ASAGASVFGA SGLDNQPPEE IVAIITSMGF QRNQAIQALR ATNNNLERAL DWIFSHPEFE EDSDFVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | entity | [U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | entity | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | entity | [U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | entity | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | entity | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | entity | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | entity | [U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | entity | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | entity | [U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | entity | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17554_2lbc.nef |
Input source #2: Coordindates | 2lbc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 DIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| DIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALR -------110-------120------ ATNNNLERALDWIFSHPEFEEDSDFV |||||||||||||||||||||||||| ATNNNLERALDWIFSHPEFEEDSDFV
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 126 | 0 | 0 | 100.0 |
Content subtype: combined_17554_2lbc.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 DIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| DIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALR -------110-------120------ ATNNNLERALDWIFSHPEFEEDSDFV |||||||||||||||||||||||||| ATNNNLERALDWIFSHPEFEEDSDFV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 724 | 577 | 79.7 |
13C chemical shifts | 553 | 351 | 63.5 |
15N chemical shifts | 137 | 119 | 86.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 255 | 249 | 97.6 |
13C chemical shifts | 252 | 126 | 50.0 |
15N chemical shifts | 119 | 119 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 469 | 328 | 69.9 |
13C chemical shifts | 301 | 225 | 74.8 |
15N chemical shifts | 18 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 62 | 88.6 |
13C chemical shifts | 70 | 62 | 88.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 0 | 0.0 |
13C chemical shifts | 67 | 0 | 0.0 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 DIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| | || ||||||||||||||||||||||||||||||| DIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGY.GAA...A.VF.ASGLDNQPPEEIVAIITSMGFQRNQAIQALR -------110-------120------ ATNNNLERALDWIFSHPEFEEDSDFV |||||||||||||||||||||||||| ATNNNLERALDWIFSHPEFEEDSDFV