BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	96.4 % (1189 of 1234)	95.7 % (616 of 644)	97.7 % (461 of 472)	94.9 % (112 of 118)
Backbone	95.5 % (617 of 646)	94.6 % (212 of 224)	96.5 % (304 of 315)	94.4 % (101 of 107)
Sidechain	97.4 % (669 of 687)	96.2 % (404 of 420)	99.2 % (254 of 256)	100.0 % (11 of 11)
Aromatic	100.0 % (92 of 92)	100.0 % (46 of 46)	100.0 % (45 of 45)	100.0 % (1 of 1)
Methyl	100.0 % (96 of 96)	100.0 % (48 of 48)	100.0 % (48 of 48)

1. AVR3a4

GSSGSSGNVD SNQNKASMLQ ARLNDEAGGT RLLRVHHESD TEERGFLEKA AVKKMAKAIM ADPNKADEVY KKWADKGYTL TQMSNFLKSK TAGKYDRVYN GYVIHLDY

Show sample condition

Sample

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
1	AVR3a4	[U-100% 13C; U-100% 15N]	1.11 mM
2	TRIS	[U-100% 2H]	20 mM
3	sodium chloride	natural abundance	300 mM
4	DTT	[U-100% 2H]	1 mM
5	sodium azide	natural abundance	0.02 %
6	D2O	natural abundance	10 %
7	H2O	natural abundance	90 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹³C	water	protons	64.851 ppm	internal	indirect	0.2514495
¹H	water	protons	4.784 ppm	internal	direct	1.0
¹⁵N	water	protons	117.597 ppm	internal	indirect	0.1013291

Referencing offset: -0.05 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹³C	water	protons	64.851 ppm	internal	indirect	0.2514495
¹H	water	protons	4.784 ppm	internal	direct	1.0
¹⁵N	water	protons	117.597 ppm	internal	indirect	0.1013291

Referencing offset: -0.05 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹³C	water	protons	64.851 ppm	internal	indirect	0.2514495
¹H	water	protons	4.784 ppm	internal	direct	1.0
¹⁵N	water	protons	117.597 ppm	internal	indirect	0.1013291

Referencing offset: 0.05 ppm, Outliers: 2 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Value	Ref. method	Ref. type	Shift ratio
¹³C	water	protons	64.851 ppm	internal	indirect	0.2514495
¹H	water	protons	4.784 ppm	internal	direct	1.0
¹⁵N	water	protons	117.597 ppm	internal	indirect	0.1013291

Referencing offset: -0.03 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2LC2, Strand ID: A Detail

Release date

2012-05-08

Citation

Phosphatidylinositol monophosphate-binding interface in the oomycete RXLR effector AVR3a is required for its stability in host cells to modulate plant immunity
Yaeno, T., Li, H., Chaparro-Garcia, A., Schornack, S., Koshiba, S., Watanabe, S., Kigawa, T., Kamoun, S., Shirasu, K.
Proc. Natl. Acad. Sci. U. S. A. (2011), 108, 14682-14687, PubMed 21821794 , DOI 10.1073/pnas.1106002108 , Abstract

Related entities 1. AVR3a4, : 1 entities Detail

Experiments performed 2 experiments Detail

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_17588_2lc2.nef
Input source #2: Coordindates	2lc2.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
GSSGSSGNVDSNQNKASMLQARLNDEAGGTRLLRVHHESDTEERGFLEKAAVKKMAKAIMADPNKADEVYKKWADKGYTLTQMSNFLKSKTAGKYDRVYN
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GSSGSSGNVDSNQNKASMLQARLNDEAGGTRLLRVHHESDTEERGFLEKAAVKKMAKAIMADPNKADEVYKKWADKGYTLTQMSNFLKSKTAGKYDRVYN

--------
GYVIHLDY
||||||||
GYVIHLDY

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	108	0	0	100.0

Content subtype: combined_17588_2lc2.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1075		86.1 (chain: A, length: 108)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	OK	2009 (1)	noe	84.3 (chain: A, length: 108)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_3	OK	90 (90)	.	49.1 (chain: A, length: 108)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 108, Sequence coverage: 86.1%
- Total number of assignments
  - ¹H chemical shifts: 556
  - ¹³C chemical shifts: 418
  - ¹⁵N chemical shifts: 101
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	644	556	86.3
¹³C chemical shifts	472	418	88.6
¹⁵N chemical shifts	123	101	82.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	224	191	85.3
¹³C chemical shifts	216	186	86.1
¹⁵N chemical shifts	107	90	84.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	420	365	86.9
¹³C chemical shifts	256	232	90.6
¹⁵N chemical shifts	16	11	68.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	52	47	90.4
¹³C chemical shifts	52	47	90.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	46	46	100.0
¹³C chemical shifts	45	45	100.0
¹⁵N chemical shifts	1	1	100.0

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 108, Sequence coverage: 84.3%
- Total number of restraints: 2004
- Weight of restraints: 1.0 (2004)
- Potential type of restraints: upper-bound-parabolic (2004)
- Range of distance target values: 2.31, 5.5 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 108, Sequence coverage: 49.1%
- Total number of restraints: 90
- Total number of restraints per polymer type: 90
- Weight of restraints: 1.0 (90)
- Potential type of restraints: square-well-parabolic (90)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue

Keywords Four helix bundle, Plant immunity, Protein binding, RXLR effector

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.638 seconds)

BMRB: 17588

Sample

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. AVR3a4, : 1 entities Detail

Experiments performed 2 experiments Detail

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail