RLIP76 (GAP-GBD)
HMPNLKPIFG IPLADAVERT MMYDGIRLPA VFRECIDYVE KYGMKCEGIY RVSGIKSKVD ELKAAYDREE STNLEDYEPN TVASLLKQYL RDLPENLLTK ELMPRFEEAC GRTTETEKVQ EFQRLLKELP ECNYLLISWL IVHMDHVIAK ELETKMNIQN ISIVLSPTVQ ISNRVLYVFF THVQELFGNV VLKQVMKPLR WSNMATMPTL PETQAGIKEE IRRQEFLLNC LHRDLQGGIK DLSKEERLWE VQRILTALKR KLREA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.8 % (2953 of 3251) | 90.3 % (1542 of 1707) | 89.8 % (1137 of 1266) | 98.6 % (274 of 278) |
Backbone | 95.2 % (1491 of 1566) | 95.8 % (506 of 528) | 93.6 % (735 of 785) | 98.8 % (250 of 253) |
Sidechain | 88.0 % (1708 of 1940) | 88.0 % (1037 of 1179) | 87.9 % (647 of 736) | 96.0 % (24 of 25) |
Aromatic | 84.6 % (176 of 208) | 91.3 % (95 of 104) | 77.2 % (78 of 101) | 100.0 % (3 of 3) |
Methyl | 98.5 % (323 of 328) | 98.8 % (162 of 164) | 98.2 % (161 of 164) |
1. RLIP76-GAP-GBD
HMPNLKPIFG IPLADAVERT MMYDGIRLPA VFRECIDYVE KYGMKCEGIY RVSGIKSKVD ELKAAYDREE STNLEDYEPN TVASLLKQYL RDLPENLLTK ELMPRFEEAC GRTTETEKVQ EFQRLLKELP ECNYLLISWL IVHMDHVIAK ELETKMNIQN ISIVLSPTVQ ISNRVLYVFF THVQELFGNV VLKQVMKPLR WSNMATMPTL PETQAGIKEE IRRQEFLLNC LHRDLQGGIK DLSKEERLWE VQRILTALKR KLREASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RLIP76-GAP-GBD | natural abundance | 0.7 mM | |
2 | TRIS | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | sodium azide | natural abundance | 0.05 % | |
5 | DTT | natural abundance | 5 mM | |
6 | H20 | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | RLIP76-GAP-GBD | [U-100% 15N] | 0.7 mM | |
9 | TRIS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | sodium azide | natural abundance | 0.05 % | |
12 | DTT | natural abundance | 5 mM | |
13 | H20 | natural abundance | 90 % | |
14 | D20 | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N] | 0.6 mM | |
16 | TRIS | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | sodium azide | natural abundance | 0.05 % | |
19 | DTT | natural abundance | 5 mM | |
20 | H20 | natural abundance | 90 % | |
21 | D20 | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.4 mM | |
23 | TRIS | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | sodium azide | natural abundance | 0.05 % | |
26 | DTT | natural abundance | 5 mM | |
27 | H20 | natural abundance | 90 % | |
28 | D20 | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | RLIP76-GAP-GBD | [U-100% 15N] | 0.7 mM | |
9 | TRIS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | sodium azide | natural abundance | 0.05 % | |
12 | DTT | natural abundance | 5 mM | |
13 | H20 | natural abundance | 90 % | |
14 | D20 | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.4 mM | |
23 | TRIS | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | sodium azide | natural abundance | 0.05 % | |
26 | DTT | natural abundance | 5 mM | |
27 | H20 | natural abundance | 90 % | |
28 | D20 | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.4 mM | |
23 | TRIS | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | sodium azide | natural abundance | 0.05 % | |
26 | DTT | natural abundance | 5 mM | |
27 | H20 | natural abundance | 90 % | |
28 | D20 | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.4 mM | |
23 | TRIS | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | sodium azide | natural abundance | 0.05 % | |
26 | DTT | natural abundance | 5 mM | |
27 | H20 | natural abundance | 90 % | |
28 | D20 | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.4 mM | |
23 | TRIS | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | sodium azide | natural abundance | 0.05 % | |
26 | DTT | natural abundance | 5 mM | |
27 | H20 | natural abundance | 90 % | |
28 | D20 | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.4 mM | |
23 | TRIS | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | sodium azide | natural abundance | 0.05 % | |
26 | DTT | natural abundance | 5 mM | |
27 | H20 | natural abundance | 90 % | |
28 | D20 | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | RLIP76-GAP-GBD | [U-100% 15N] | 0.7 mM | |
9 | TRIS | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | sodium azide | natural abundance | 0.05 % | |
12 | DTT | natural abundance | 5 mM | |
13 | H20 | natural abundance | 90 % | |
14 | D20 | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N] | 0.6 mM | |
16 | TRIS | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | sodium azide | natural abundance | 0.05 % | |
19 | DTT | natural abundance | 5 mM | |
20 | H20 | natural abundance | 90 % | |
21 | D20 | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N] | 0.6 mM | |
16 | TRIS | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | sodium azide | natural abundance | 0.05 % | |
19 | DTT | natural abundance | 5 mM | |
20 | H20 | natural abundance | 90 % | |
21 | D20 | natural abundance | 10 % |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N] | 0.6 mM | |
16 | TRIS | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | sodium azide | natural abundance | 0.05 % | |
19 | DTT | natural abundance | 5 mM | |
20 | H20 | natural abundance | 90 % | |
21 | D20 | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N] | 0.6 mM | |
16 | TRIS | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | sodium azide | natural abundance | 0.05 % | |
19 | DTT | natural abundance | 5 mM | |
20 | H20 | natural abundance | 90 % | |
21 | D20 | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N] | 0.6 mM | |
16 | TRIS | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | sodium azide | natural abundance | 0.05 % | |
19 | DTT | natural abundance | 5 mM | |
20 | H20 | natural abundance | 90 % | |
21 | D20 | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | RLIP76-GAP-GBD | [U-100% 13C; U-100% 15N] | 0.6 mM | |
16 | TRIS | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | sodium azide | natural abundance | 0.05 % | |
19 | DTT | natural abundance | 5 mM | |
20 | H20 | natural abundance | 90 % | |
21 | D20 | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_17608_2mbg.nef |
Input source #2: Coordindates | 2mbg.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------190-------200-------210-------220-------230-------240-------250-------260-------270-------280- HMPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HMPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------290-------300-------310-------320-------330-------340-------350-------360-------370-------380- ELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLR -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 ------390-------400-------410-------420-------430-------440------ WSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| WSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA -------210-------220-------230-------240-------250-------260-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 265 | 0 | 0 | 100.0 |
Content subtype: combined_17608_2mbg.nef
Assigned chemical shifts
------190-------200-------210-------220-------230-------240-------250-------260-------270-------280- HMPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HMPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTK ------290-------300-------310-------320-------330-------340-------350-------360-------370-------380- ELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLR ------390-------400-------410-------420-------430-------440------ WSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| W.NMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
201 | THR | HG1 | 4.452 |
280 | THR | HG1 | 6.12 |
319 | SER | HG | 4.091 |
335 | THR | HG1 | 3.567 |
343 | SER | HG | 4.811 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1707 | 1522 | 89.2 |
13C chemical shifts | 1266 | 1122 | 88.6 |
15N chemical shifts | 296 | 269 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 528 | 510 | 96.6 |
13C chemical shifts | 530 | 486 | 91.7 |
15N chemical shifts | 253 | 246 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1179 | 1012 | 85.8 |
13C chemical shifts | 736 | 636 | 86.4 |
15N chemical shifts | 43 | 23 | 53.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 174 | 172 | 98.9 |
13C chemical shifts | 174 | 171 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 104 | 95 | 91.3 |
13C chemical shifts | 101 | 78 | 77.2 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
------190-------200-------210-------220-------230-------240-------250-------260-------270-------280- HMPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HMPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTK ------290-------300-------310-------320-------330-------340-------350-------360-------370-------380- ELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLR ------390-------400-------410-------420-------430-------440------ WSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| WSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA
------190-------200-------210-------220-------230-------240-------250-------260-------270-------280- HMPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTK |||||||| ||||||||||||| |||||||||| |||||||||||||| | ............LADAVERT.........AVFRECIDYVEKY...............KVDELKAAYD...........PNTVASLLKQYLRD......T. ------190-------200-------210-------220-------230-------240-------250-------260-------270-------280- ------290-------300-------310-------320-------330-------340-------350-------360-------370-------380- ELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLR | || || |||||||||||||| |||||||||||||||||||||||| ||||||||| |||||||||||| ..M.RF..AC....ETEKVQEFQRLLKE..ECNYLLISWLIVHMDHVIAKELET...IQNISIVLS........VLYVFFTHVQEL.............. ------290-------300-------310-------320-------330-------340-------350-------360-------370-------380- ------390-------400-------410-------420-------430-------440------ WSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA ||||||||||||||||||||| |||||||||||||||||||||| .............QAGIKEEIRRQEFLLNCLHRD......DLSKEERLWEVQRILTALKRKL ------390-------400-------410-------420-------430-------440---
Dihedral angle restraints
------190-------200-------210-------220-------230-------240-------250-------260-------270-------280- HMPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTK ||| |||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....KPI.GIPLADAVERTM.YDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTK ------190-------200-------210-------220-------230-------240-------250-------260-------270-------280- ------290-------300-------310-------320-------330-------340-------350-------360-------370-------380- ELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||| ELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELF.NVVLKQVMKPL. ------290-------300-------310-------320-------330-------340-------350-------360-------370-------380- ------390-------400-------410-------420-------430-------440------ WSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA |||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........TLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLRE ------390-------400-------410-------420-------430-------440-----
RDC restraints