Solution NMR Structure of a Protein With a Redesigned Hydrophobic Core, Northeast Structural Genomics Consortium Target OR38
MGSHQEYIKK VTDELKELIQ NVNDDIKEVE KNPEDMEYWN KIYRLVHTMK EITETMGFSS VAKVLHTIMN LVDKMLNSEI KITSDLIDKV KKKLDMVTRE LDKKVSGSYL VPR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.5 % (1284 of 1388) | 92.7 % (676 of 729) | 91.3 % (492 of 539) | 96.7 % (116 of 120) |
Backbone | 95.5 % (644 of 674) | 94.7 % (215 of 227) | 95.8 % (322 of 336) | 96.4 % (107 of 111) |
Sidechain | 90.7 % (747 of 824) | 91.8 % (461 of 502) | 88.5 % (277 of 313) | 100.0 % (9 of 9) |
Aromatic | 59.1 % (39 of 66) | 66.7 % (22 of 33) | 50.0 % (16 of 32) | 100.0 % (1 of 1) |
Methyl | 89.0 % (121 of 136) | 95.6 % (65 of 68) | 82.4 % (56 of 68) |
1. OR38
MGSHQEYIKK VTDELKELIQ NVNDDIKEVE KNPEDMEYWN KIYRLVHTMK EITETMGFSS VAKVLHTIMN LVDKMLNSEI KITSDLIDKV KKKLDMVTRE LDKKVSGSYL VPRSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR38 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-10% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | OR38 | [U-10% 13C; U-100% 15N] | 1.0 mM | |
7 | sodium phosphate | natural abundance | 100 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR38 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR38 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR38 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR38 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR38 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR38 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR38 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR38 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR38 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-10% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | OR38 | [U-10% 13C; U-100% 15N] | 1.0 mM | |
7 | sodium phosphate | natural abundance | 100 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-100% 13C; U-100% 15N] OR38, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR38 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17612_2lch.nef |
Input source #2: Coordindates | 2lch.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRE -------110--- LDKKVSGSYLVPR ||||||||||||| LDKKVSGSYLVPR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 113 | 0 | 0 | 100.0 |
Content subtype: combined_17612_2lch.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRE | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||| .G.HQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKIT.DLIDKVKKKLDMVTRE -------110--- LDKKVSGSYLVPR ||||||||||||| LDKKVSGSYLVPR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 729 | 691 | 94.8 |
13C chemical shifts | 539 | 489 | 90.7 |
15N chemical shifts | 123 | 112 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 227 | 216 | 95.2 |
13C chemical shifts | 226 | 215 | 95.1 |
15N chemical shifts | 111 | 103 | 92.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 502 | 475 | 94.6 |
13C chemical shifts | 313 | 274 | 87.5 |
15N chemical shifts | 12 | 9 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 75 | 72 | 96.0 |
13C chemical shifts | 75 | 59 | 78.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 25 | 75.8 |
13C chemical shifts | 32 | 15 | 46.9 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||| ...HQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKIT.DLIDKVKKKLDMVTRE -------110--- LDKKVSGSYLVPR ||||||||||||| LDKKVSGSYLVPR
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSHQEYIKKVTDELKELIQNVNDDIKEVEKNPEDMEYWNKIYRLVHTMKEITETMGFSSVAKVLHTIMNLVDKMLNSEIKITSDLIDKVKKKLDMVTRE ||||||||||||||||||||||||||||| |||||||||||||||||||||| |||||||||||||||||||| ||||||||||||||||| ...HQEYIKKVTDELKELIQNVNDDIKEVEKN..DMEYWNKIYRLVHTMKEITETM.FSSVAKVLHTIMNLVDKMLN......SDLIDKVKKKLDMVTRE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110--- LDKKVSGSYLVPR |||||| LDKKVS ------