Solution structure of the EF-hand domain of Human Polycystin 2
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 66.0 % (595 of 901) | 76.3 % (363 of 476) | 48.2 % (163 of 338) | 79.3 % (69 of 87) |
Backbone | 77.4 % (367 of 474) | 92.8 % (154 of 166) | 62.9 % (144 of 229) | 87.3 % (69 of 79) |
Sidechain | 58.2 % (290 of 498) | 67.4 % (209 of 310) | 45.0 % (81 of 180) | 0.0 % (0 of 8) |
Aromatic | 20.0 % (8 of 40) | 40.0 % (8 of 20) | 0.0 % (0 of 20) | |
Methyl | 35.9 % (23 of 64) | 12.5 % (4 of 32) | 59.4 % (19 of 32) |
1. POLYCYSTIN-2
GGSLKKNTVD DISESLRQGG GKLNFDELRQ DLKGKGHTDA EIEAIFTKYD QDGDQELTEH EHQQMRDDLE KEREDLDLDSolvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid NH3 | nitrogen | 0.0 ppm | external | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid NH3 | nitrogen | 0.0 ppm | external | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid NH3 | nitrogen | 0.0 ppm | external | direct | 1.0 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% water / 5% D2O, Pressure 1 atm, Temperature 298.000 K, pH 6.500, Details 1.5 mM
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | POLYCYSTIN-2 | [U-13C; U-15N] | 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | Potassium phosphate | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_17621_2y4q.nef |
Input source #2: Coordindates | 2y4q.cif |
Diamagnetism of the molecular assembly | False (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
2:1:CA:CA | 1:52:ASP:OD1 | unknown | unknown | n/a |
2:1:CA:CA | 1:54:ASP:OD1 | unknown | unknown | n/a |
2:1:CA:CA | 1:54:ASP:OD2 | unknown | unknown | n/a |
2:1:CA:CA | 1:50:ASP:OD2 | unknown | unknown | n/a |
2:1:CA:CA | 1:56:GLU:O | unknown | unknown | n/a |
2:1:CA:CA | 1:52:ASP:OD2 | unknown | unknown | n/a |
2:1:CA:CA | 1:61:GLU:OE1 | unknown | unknown | n/a |
2:1:CA:CA | 1:61:GLU:OE2 | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | CA | CALCIUM ION | None |
Sequence alignments
----720-------730-------740-------750-------760-------770-------780-------790-- GGSLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GGSLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLD --------10--------20--------30--------40--------50--------60--------70---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 79 | 0 | 0 | 100.0 |
Content subtype: combined_17621_2y4q.nef
Assigned chemical shifts
----720-------730-------740-------750-------760-------770-------780-------790-- GGSLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GGSLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
15N chemical shifts | 91 | 69 | 75.8 |
1H chemical shifts | 476 | 360 | 75.6 |
13C chemical shifts | 338 | 152 | 45.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
15N chemical shifts | 79 | 69 | 87.3 |
1H chemical shifts | 166 | 153 | 92.2 |
13C chemical shifts | 158 | 74 | 46.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
15N chemical shifts | 12 | 0 | 0.0 |
1H chemical shifts | 310 | 207 | 66.8 |
13C chemical shifts | 180 | 78 | 43.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 0 | 0.0 |
13C chemical shifts | 33 | 18 | 54.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 20 | 8 | 40.0 |
13C chemical shifts | 20 | 0 | 0.0 |
Covalent bonds
Distance restraints
----720-------730-------740-------750-------760-------770-------780-------790-- GGSLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GSLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLD
Dihedral angle restraints
----720-------730-------740-------750-------760-------770-------780-------790-- GGSLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...LKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKER ----720-------730-------740-------750-------760-------770-------780------
RDC restraints
----720-------730-------740-------750-------760-------770-------780-------790-- GGSLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLD ||||| || | ||| | ||| || ||||||||| |||||||| ||| ||| ||| | || | | || ..SLKKN.VD.I..SLR...G..NFD..RQ.LKGKGHTDA..EAIFTKYD.DGD..LTE.EHQ....D.EK..E.L.LD