NMR Structure of Alk1 extracellular domain
DPVKPSRGPL VTCTCESPHC KGPTCRGAWC TVVLVREEGR HPQEHRGCGN LHRELCRGRP TEFVNHYCCD SHLCNHNVSL VLEATQPPSE QPGTDGQ
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS13:SG | 1:CYS30:SG |
2 | disulfide | sing | 1:CYS15:SG | 1:CYS20:SG |
3 | disulfide | sing | 1:CYS25:SG | 1:CYS48:SG |
4 | disulfide | sing | 1:CYS56:SG | 1:CYS68:SG |
5 | disulfide | sing | 1:CYS69:SG | 1:CYS74:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 82.0 % (870 of 1061) | 75.4 % (420 of 557) | 89.7 % (366 of 408) | 87.5 % (84 of 96) |
Backbone | 98.2 % (552 of 562) | 97.9 % (189 of 193) | 98.9 % (279 of 282) | 96.6 % (84 of 87) |
Sidechain | 69.0 % (405 of 587) | 63.5 % (231 of 364) | 81.3 % (174 of 214) | 0.0 % (0 of 9) |
Aromatic | 6.9 % (4 of 58) | 6.9 % (2 of 29) | 7.1 % (2 of 28) | 0.0 % (0 of 1) |
Methyl | 100.0 % (78 of 78) | 100.0 % (39 of 39) | 100.0 % (39 of 39) |
1. Alk1
DPVKPSRGPL VTCTCESPHC KGPTCRGAWC TVVLVREEGR HPQEHRGCGN LHRELCRGRP TEFVNHYCCD SHLCNHNVSL VLEATQPPSE QPGTDGQSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alk1 | [U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
12 | sodium phosphate | natural abundance | 25 mM | |
13 | sodium azide | natural abundance | 0.02 % | |
14 | Pf1 phage | natural abundance | 5mg/mL mg | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alk1 | [U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alk1 | [U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Alk1 | [U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium azide | natural abundance | 0.02 % | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Bruker Avance - 700 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 305 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Alk1 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
12 | sodium phosphate | natural abundance | 25 mM | |
13 | sodium azide | natural abundance | 0.02 % | |
14 | Pf1 phage | natural abundance | 5mg/mL mg | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_17628_2lcr.nef |
Input source #2: Coordindates | 2lcr.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:13:CYS:SG | A:30:CYS:SG | oxidized, CA 52.122, CB 42.407 ppm | oxidized, CA 51.697, CB 38.255 ppm | 2.027 |
A:15:CYS:SG | A:20:CYS:SG | oxidized, CA 57.007, CB 37.153 ppm | oxidized, CA 57.764, CB 42.002 ppm | 2.027 |
A:25:CYS:SG | A:48:CYS:SG | oxidized, CA 53.487, CB 46.385 ppm | oxidized, CA 58.6, CB 44.933 ppm | 2.036 |
A:56:CYS:SG | A:68:CYS:SG | oxidized, CA 55.883, CB 38.516 ppm | oxidized, CA 51.895, CB 45.198 ppm | 2.03 |
A:69:CYS:SG | A:74:CYS:SG | oxidized, CA 54.996, CB 44.9 ppm | oxidized, CA 58.56, CB 44.268 ppm | 2.028 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ MTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 - Q | Q -
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 101 | 0 | 0 | 100.0 |
Content subtype: combined_17628_2lcr.nef
Assigned chemical shifts
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ MTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| .....PVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQ.PSEQPGTDG - Q | Q
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 579 | 402 | 69.4 |
13C chemical shifts | 423 | 361 | 85.3 |
15N chemical shifts | 109 | 84 | 77.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 202 | 188 | 93.1 |
13C chemical shifts | 202 | 190 | 94.1 |
15N chemical shifts | 91 | 84 | 92.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 377 | 214 | 56.8 |
13C chemical shifts | 221 | 171 | 77.4 |
15N chemical shifts | 18 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 39 | 95.1 |
13C chemical shifts | 41 | 39 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 29 | 0 | 0.0 |
13C chemical shifts | 28 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Covalent bonds
Distance restraints
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ MTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| .....PVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQ.PSEQPGTDG - Q | Q
Dihedral angle restraints
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ MTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDG |||||||||||||||||||||||||||| ||||||||||||||||||| ||| |||||||| ||| || ||| ............PLVTCTCESPHCKGPTCRGAWCTVVLVR.EGRHPQEHRGCGNLHRELC.GRP....NHYCCDSH.....VSL....TQ...EQP ------------10--------20--------30--------40--------50--------60--------70--------80--------90-- - Q
RDC restraints