NMR structure of BC28.1
SSGIEGCTED EKRDSVVEGA TSVEASLKEQ IDWLAERYSA DLTNKDTSKW NTDEKVKELL NEKAVGIESR LLAIAKEFHK LKSVLCTGVN ETPAHVANRV SPGDAISMLY VLSITHRELS SLKNKIDEWK KVKASEDGTK VIQNIKDDRT NTWFVAHGFK VAELNDVTLE KLATVVNELV SHKDMIYIND AMKQNVDKWT KEESERLAMM AEQGISGAKG KKD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.8 % (2183 of 2574) | 91.0 % (1217 of 1337) | 74.4 % (740 of 995) | 93.4 % (226 of 242) |
Backbone | 96.1 % (1282 of 1334) | 98.7 % (449 of 455) | 93.3 % (614 of 658) | 99.1 % (219 of 221) |
Sidechain | 74.8 % (1086 of 1452) | 87.1 % (768 of 882) | 56.6 % (311 of 549) | 33.3 % (7 of 21) |
Aromatic | 40.3 % (54 of 134) | 73.1 % (49 of 67) | 0.0 % (0 of 62) | 100.0 % (5 of 5) |
Methyl | 90.8 % (236 of 260) | 99.2 % (129 of 130) | 82.3 % (107 of 130) |
1. BC28.1
SSGIEGCTED EKRDSVVEGA TSVEASLKEQ IDWLAERYSA DLTNKDTSKW NTDEKVKELL NEKAVGIESR LLAIAKEFHK LKSVLCTGVN ETPAHVANRV SPGDAISMLY VLSITHRELS SLKNKIDEWK KVKASEDGTK VIQNIKDDRT NTWFVAHGFK VAELNDVTLE KLATVVNELV SHKDMIYIND AMKQNVDKWT KEESERLAMM AEQGISGAKG KKDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BC28.1 | [U-15N] | 0.5 (±0.02) mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Sodium phosphate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | BC28.1 | [U-13C; U-15N] | 0.5 (±0.02) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | Sodium phosphate | natural abundance | 10 mM | |
10 | NaCl | natural abundance | 50 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | BC28.1 | natural abundance | 0.1 (±0.005) mM | |
12 | D2O | natural abundance | 100 % | |
13 | sodium phosphate | natural abundance | 10 mM | |
14 | NaCl | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BC28.1 | [U-15N] | 0.5 (±0.02) mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Sodium phosphate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BC28.1 | [U-15N] | 0.5 (±0.02) mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Sodium phosphate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | BC28.1 | [U-13C; U-15N] | 0.5 (±0.02) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | Sodium phosphate | natural abundance | 10 mM | |
10 | NaCl | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | BC28.1 | [U-13C; U-15N] | 0.5 (±0.02) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | Sodium phosphate | natural abundance | 10 mM | |
10 | NaCl | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | BC28.1 | [U-13C; U-15N] | 0.5 (±0.02) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | Sodium phosphate | natural abundance | 10 mM | |
10 | NaCl | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | BC28.1 | [U-13C; U-15N] | 0.5 (±0.02) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | Sodium phosphate | natural abundance | 10 mM | |
10 | NaCl | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | BC28.1 | [U-13C; U-15N] | 0.5 (±0.02) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | Sodium phosphate | natural abundance | 10 mM | |
10 | NaCl | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | BC28.1 | [U-13C; U-15N] | 0.5 (±0.02) mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | Sodium phosphate | natural abundance | 10 mM | |
10 | NaCl | natural abundance | 50 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | BC28.1 | natural abundance | 0.1 (±0.005) mM | |
12 | D2O | natural abundance | 100 % | |
13 | sodium phosphate | natural abundance | 10 mM | |
14 | NaCl | natural abundance | 50 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | BC28.1 | natural abundance | 0.1 (±0.005) mM | |
12 | D2O | natural abundance | 100 % | |
13 | sodium phosphate | natural abundance | 10 mM | |
14 | NaCl | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17633_2lcu.nef |
Input source #2: Coordindates | 2lcu.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SSGIEGCTEDEKRDSVVEGATSVEASLKEQIDWLAERYSADLTNKDTSKWNTDEKVKELLNEKAVGIESRLLAIAKEFHKLKSVLCTGVNETPAHVANRV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SSGIEGCTEDEKRDSVVEGATSVEASLKEQIDWLAERYSADLTNKDTSKWNTDEKVKELLNEKAVGIESRLLAIAKEFHKLKSVLCTGVNETPAHVANRV -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 SPGDAISMLYVLSITHRELSSLKNKIDEWKKVKASEDGTKVIQNIKDDRTNTWFVAHGFKVAELNDVTLEKLATVVNELVSHKDMIYINDAMKQNVDKWT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SPGDAISMLYVLSITHRELSSLKNKIDEWKKVKASEDGTKVIQNIKDDRTNTWFVAHGFKVAELNDVTLEKLATVVNELVSHKDMIYINDAMKQNVDKWT -------210-------220--- KEESERLAMMAEQGISGAKGKKD ||||||||||||||||||||||| KEESERLAMMAEQGISGAKGKKD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 223 | 0 | 0 | 100.0 |
Content subtype: combined_17633_2lcu.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SSGIEGCTEDEKRDSVVEGATSVEASLKEQIDWLAERYSADLTNKDTSKWNTDEKVKELLNEKAVGIESRLLAIAKEFHKLKSVLCTGVNETPAHVANRV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SGIEGCTEDEKRDSVVEGATSVEASLKEQIDWLAERYSADLTNKDTSKWNTDEKVKELLNEKAVGIESRLLAIAKEFHKLKSVLCTGVNETPAHVANRV -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 SPGDAISMLYVLSITHRELSSLKNKIDEWKKVKASEDGTKVIQNIKDDRTNTWFVAHGFKVAELNDVTLEKLATVVNELVSHKDMIYINDAMKQNVDKWT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SPGDAISMLYVLSITHRELSSLKNKIDEWKKVKASEDGTKVIQNIKDDRTNTWFVAHGFKVAELNDVTLEKLATVVNELVSHKDMIYINDAMKQNVDKWT -------210-------220--- KEESERLAMMAEQGISGAKGKKD ||||||||||||||||||||||| KEESERLAMMAEQGISGAKGKKD
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
79 | HIS | HD1 | 7.231 |
95 | HIS | HD1 | 7.21 |
116 | HIS | HD1 | 6.98 |
182 | HIS | HD1 | 7.104 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1337 | 1193 | 89.2 |
13C chemical shifts | 995 | 671 | 67.4 |
15N chemical shifts | 249 | 224 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 455 | 447 | 98.2 |
13C chemical shifts | 446 | 422 | 94.6 |
15N chemical shifts | 221 | 219 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 882 | 746 | 84.6 |
13C chemical shifts | 549 | 249 | 45.4 |
15N chemical shifts | 28 | 5 | 17.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 135 | 130 | 96.3 |
13C chemical shifts | 135 | 92 | 68.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 47 | 70.1 |
13C chemical shifts | 62 | 0 | 0.0 |
15N chemical shifts | 5 | 5 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SSGIEGCTEDEKRDSVVEGATSVEASLKEQIDWLAERYSADLTNKDTSKWNTDEKVKELLNEKAVGIESRLLAIAKEFHKLKSVLCTGVNETPAHVANRV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..GIEGCTEDEKRDSVVEGATSVEASLKEQIDWLAERYSADLTNKDTSKWNTDEKVKELLNEKAVGIESRLLAIAKEFHKLKSVLCTGVNETPAHVANRV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 SPGDAISMLYVLSITHRELSSLKNKIDEWKKVKASEDGTKVIQNIKDDRTNTWFVAHGFKVAELNDVTLEKLATVVNELVSHKDMIYINDAMKQNVDKWT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SPGDAISMLYVLSITHRELSSLKNKIDEWKKVKASEDGTKVIQNIKDDRTNTWFVAHGFKVAELNDVTLEKLATVVNELVSHKDMIYINDAMKQNVDKWT -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 -------210-------220--- KEESERLAMMAEQGISGAKGKKD ||||||||||||| KEESERLAMMAEQ -------210---
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SSGIEGCTEDEKRDSVVEGATSVEASLKEQIDWLAERYSADLTNKDTSKWNTDEKVKELLNEKAVGIESRLLAIAKEFHKLKSVLCTGVNETPAHVANRV |||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........DEKRDS........EASLKEQIDWLAERYSADLTNKDTSKWNTDEKVKELLNEKAVGIESRLLAIAKEFHKLKSVLCTGVNETPAHVANRV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 SPGDAISMLYVLSITHRELSSLKNKIDEWKKVKASEDGTKVIQNIKDDRTNTWFVAHGFKVAELNDVTLEKLATVVNELVSHKDMIYINDAMKQNVDKWT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SPGDAISMLYVLSITHRELSSLKNKIDEWKKVKASEDGTKVIQNIKDDRTNTWFVAHGFKVAELNDVTLEKLATVVNELVSHKDMIYINDAMKQNVDKWT -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 -------210-------220--- KEESERLAMMAEQGISGAKGKKD |||||||||||||| KEESERLAMMAEQG -------210----