BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	88.6 % (1083 of 1222)	85.4 % (545 of 638)	90.3 % (421 of 466)	99.2 % (117 of 118)
Backbone	96.1 % (615 of 640)	93.8 % (212 of 226)	96.8 % (300 of 310)	99.0 % (103 of 104)
Sidechain	82.7 % (559 of 676)	80.8 % (333 of 412)	84.8 % (212 of 250)	100.0 % (14 of 14)
Aromatic	42.9 % (42 of 98)	46.9 % (23 of 49)	37.5 % (18 of 48)	100.0 % (1 of 1)
Methyl	95.7 % (90 of 94)	95.7 % (45 of 47)	95.7 % (45 of 47)

1. FUS/TLS RRM domain

EQDNSDNNTI FVQGLGENVT IESVADYFKQ IGIIKTNKKT GQPMINLYTD RETGKLKGEA TVSFDDPPSA KAAIDWFDGK EFSGNPIKVS FATRRADFNR GGGNGRGG

Show sample condition

Sample

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0

#	Name	Isotope labeling	Concentration
1	DSS	natural abundance	0.5 mM
2	Tris	natural abundance	20 mM
3	NaCl	natural abundance	50 mM
4	H2O	natural abundance	10 %
5	D2O	[U-100% 2H]	90 %
6	NaN3	natural abundance	0.02 %
7	FUS_TLS_RRM_domain	[U-100% 15N; U-100% 13C]	1 mM

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.14 ppm, Outliers: 2 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.14 ppm, Outliers: 2 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: -0.02 ppm, Outliers: 2 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	internal	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	internal	indirect	0.1013291

Referencing offset: 1.73 ppm, Outliers: 3 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2LCW, Strand ID: A Detail

Release date

2012-06-03

Citation

TLS-RRM is a promiscuous nucleic acid binding domain
Liu, X., Ren, J., Niu, C., Feng, W., Gong, W.
Not known

Related entities 1. FUS/TLS RRM domain, : 1 : 8 : 1 : 218 entities Detail

Interaction partners 1. FUS/TLS RRM domain, : 117 interactors Detail

More details for 117 interactors identified by 39 citations

Experiments performed 1 experiments Detail

NMR combined restraints 5 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_17635_2lcw.nef
Input source #2: Coordindates	2lcw.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--280-----290-------300-------310-------320-------330-------340-------350-------360-------370-------
EQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNR
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
EQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNR
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100

380-------390---
GGGNGRGGLEHHHHHH
||||||||||||||||
GGGNGRGGLEHHHHHH
-------110------

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	116	0	0	100.0

Content subtype: combined_17635_2lcw.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1124		93.1 (chain: A, length: 116)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	Warning	2493 (1)	noe	92.2 (chain: A, length: 116)
2	Distance restraints	CNS/XPLOR_distance_constraints_3	Warning	18 (1)	hbond	25.9 (chain: A, length: 116)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_4	OK	94 (94)	.	60.3 (chain: A, length: 116)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1

Status: Warning

Sequence coverage of experimental data

Entity_assembly_ID: A, Chain length: 116, Sequence coverage: 93.1%

--280-----290-------300-------310-------320-------330-------340-------350-------360-------370-------
EQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNR
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
EQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNR
--280-----290-------300-------310-------320-------330-------340-------350-------360-------370-------

380-------390---
GGGNGRGGLEHHHHHH
||||||||        
GGGNGRGG        
380-----

Total number of assignments
- ¹H chemical shifts: 561
- ¹³C chemical shifts: 446
- ¹⁵N chemical shifts: 117

Completeness of assignments

Entity_assemble_ID: A

Excluded Atom_ID in statistics

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
279	GLN	CD	182.095
281	ASN	CG	173.005
284	ASN	CG	173.792
290	GLN	CD	181.893
295	ASN	CG	172.618
307	GLN	CD	182.286
314	ASN	CG	173.207
319	GLN	CD	182.295
323	ASN	CG	173.942
362	ASN	CG	173.345
376	ASN	CG	173.452
381	ASN	CG	173.294

All atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	687	561	81.7
¹³C chemical shifts	506	434	85.8
¹⁵N chemical shifts	131	117	89.3

Backbone atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	242	219	90.5
¹³C chemical shifts	232	215	92.7
¹⁵N chemical shifts	112	103	92.0

Side chain atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	445	342	76.9
¹³C chemical shifts	274	219	79.9
¹⁵N chemical shifts	19	14	73.7

Methyl group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	50	48	96.0
¹³C chemical shifts	50	48	96.0

Aromatic group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	61	23	37.7
¹³C chemical shifts	60	18	30.0
¹⁵N chemical shifts	1	1	100.0

Peptide bond of PRO
Rotameric state of ILE , LEU, and VAL
Histogram of normalized assigned chemical shifts
Random coil index and derived parameters (S² and NMR RMSD)
- Chain_ID: A

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 116, Sequence coverage: 92.2%
- Total number of restraints: 2493
- Weight of restraints: 1.0 (2493)
- Potential type of restraints: square-well-parabolic (2493)
- Range of distance target values: 2.35, 5.6 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_3
  - Status: Warning
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 116, Sequence coverage: 25.9%
  - Total number of restraints: 18
  - Weight of restraints: 1.0 (18)
  - Potential type of restraints: square-well-parabolic (18)
  - Range of distance target values: 2.0, 2.0 (Å)
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_4
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 116, Sequence coverage: 60.3%
- Total number of restraints: 94
- Total number of restraints per polymer type: 94
- Weight of restraints: 1.0 (94)
- Potential type of restraints: square-well-parabolic (94)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords RRM

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (7.76 seconds)

BMRB: 17635

Sample

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. FUS/TLS RRM domain, : 1 : 8 : 1 : 218 entities Detail

Interaction partners 1. FUS/TLS RRM domain, : 117 interactors Detail

Experiments performed 1 experiments Detail

Instrument

Sample

NMR combined restraints 5 contents Detail