BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	86.7 % (926 of 1068)	91.6 % (521 of 569)	79.7 % (321 of 403)	87.5 % (84 of 96)
Backbone	84.0 % (440 of 524)	94.9 % (169 of 178)	71.9 % (187 of 260)	97.7 % (84 of 86)
Sidechain	90.8 % (570 of 628)	90.0 % (352 of 391)	96.0 % (218 of 227)	0.0 % (0 of 10)
Aromatic	0.0 % (0 of 18)	0.0 % (0 of 9)	0.0 % (0 of 9)
Methyl	100.0 % (100 of 100)	100.0 % (50 of 50)	100.0 % (50 of 50)

1. myosin VI LAE

QGPGSLVKVG TLKKRLDKFN EVVSALKDGK PEVNRQIKNL EISIDALMAK IKSTMMTREQ IQKEYDALVK SSEDLLSALQ KKKQQEEE

Show sample condition

Sample #1

Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5

#	Name	Isotope labeling	Concentration
1	myosin VI LAE	natural abundance	1.0 mM
2	D2O	natural abundance	100 %
3	sodium phosphate	natural abundance	50 mM

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5

#	Name	Isotope labeling	Concentration
4	myosin VI LAE	[U-100% 15N]	1.0 mM
5	H2O	natural abundance	90 %
6	D2O	natural abundance	10 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5

#	Name	Isotope labeling	Concentration
7	myosin VI LAE	[U-100% 13C; U-100% 15N]	1.0 mM
8	H20	natural abundance	90 %
9	D20	natural abundance	10 %

Sample #4

Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5

#	Name	Isotope labeling	Type	Concentration
10	myosin VI LAE	[U-100% 13C; U-100% 15N]		1.0 mM
11	D2O	natural abundance		100 %

Protein Blocks Logo

Calculated from 20 models in PDB: 2LD3, Strand ID: A Detail

Release date

2012-08-29

Citation

Membrane-induced lever arm expansion allows myosin VI to walk with large and variable step sizes
Yu, C., Lou, J., Wu, J., Pan, L., Feng, W., Zhang, M.
J. Biol. Chem. (2012), 287, 35021-35035, PubMed 22936804 , DOI 10.1074/jbc.M111.328781 , Abstract

Related entities 1. myosin VI lever arm extension, : 1 : 2 : 29 entities Detail

Interaction partners 1. myosin VI lever arm extension, : 15 interactors Detail

More details for 15 interactors identified by 5 citations

Experiments performed 6 experiments Detail

NMR combined restraints 5 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_17645_2ld3.nef
Input source #2: Coordindates	2ld3.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

---20--------30--------40--------50--------60--------70--------80--------90-------100---
QGPGSLVKVGTLKKRLDKFNEVVSALKDGKPEVNRQIKNLEISIDALMAKIKSTMMTREQIQKEYDALVKSSEDLLSALQKKKQQEEE
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
QGPGSLVKVGTLKKRLDKFNEVVSALKDGKPEVNRQIKNLEISIDALMAKIKSTMMTREQIQKEYDALVKSSEDLLSALQKKKQQEEE
--------10--------20--------30--------40--------50--------60--------70--------80--------

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	88	0	0	100.0

Content subtype: combined_17645_2ld3.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	921		100.0 (chain: A, length: 88)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	Warning	2763 (1)	noe	100.0 (chain: A, length: 88)
2	Distance restraints	CNS/XPLOR_distance_constraints_3	OK	128 (1)	hbond	81.8 (chain: A, length: 88)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_4	OK	138 (138)	.	85.2 (chain: A, length: 88)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 88, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 533
  - ¹³C chemical shifts: 305
  - ¹⁵N chemical shifts: 83
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	569	532	93.5
¹³C chemical shifts	403	305	75.7
¹⁵N chemical shifts	99	83	83.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	178	174	97.8
¹³C chemical shifts	176	88	50.0
¹⁵N chemical shifts	86	83	96.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	391	358	91.6
¹³C chemical shifts	227	217	95.6
¹⁵N chemical shifts	13	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	53	52	98.1
¹³C chemical shifts	53	52	98.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	9	0	0.0
¹³C chemical shifts	9	0	0.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 88, Sequence coverage: 100.0%
- Total number of restraints: 2763
- Weight of restraints: 1.0 (2763)
- Potential type of restraints: square-well-parabolic (2763)
- Range of distance target values: 2.25, 5.8 (Å)
- Histogram of distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_3
  - Status: OK
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 88, Sequence coverage: 81.8%
  - Total number of restraints: 128
  - Weight of restraints: 1.0 (128)
  - Potential type of restraints: square-well-parabolic (128)
  - Range of distance target values: 2.0, 2.75 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_4
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 88, Sequence coverage: 85.2%
- Total number of restraints: 138
- Total number of restraints per polymer type: 138
- Weight of restraints: 1.0 (138)
- Potential type of restraints: square-well-parabolic (138)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords lever arm extension, molecular motor, myosin VI

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (4.638 seconds)

BMRB: 17645

Sample #1

Sample #2

Sample #3

Sample #4

Related entities 1. myosin VI lever arm extension, : 1 : 2 : 29 entities Detail

Interaction partners 1. myosin VI lever arm extension, : 15 interactors Detail

Experiments performed 6 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 5 contents Detail