solution structure of the mSin3A PAH3-SAP30 SID complex
SNAGSDDDGG DSPVQDIDTP EVDLYQLQVN TLRRYKRHFK LPTRPGLNKA QLVEIVGCHF KSIPVNEKDT LTCFIYSVRN DKNKSDLKAD SGVH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.8 % (1788 of 2014) | 86.7 % (911 of 1051) | 89.7 % (702 of 783) | 97.2 % (175 of 180) |
Backbone | 97.0 % (970 of 1000) | 95.3 % (325 of 341) | 98.0 % (487 of 497) | 97.5 % (158 of 162) |
Sidechain | 83.1 % (975 of 1173) | 82.5 % (586 of 710) | 83.6 % (372 of 445) | 94.4 % (17 of 18) |
Aromatic | 42.0 % (79 of 188) | 58.5 % (55 of 94) | 24.7 % (23 of 93) | 100.0 % (1 of 1) |
Methyl | 100.0 % (176 of 176) | 100.0 % (88 of 88) | 100.0 % (88 of 88) |
1. SAP30
SNAGSDDDGG DSPVQDIDTP EVDLYQLQVN TLRRYKRHFK LPTRPGLNKA QLVEIVGCHF KSIPVNEKDT LTCFIYSVRN DKNKSDLKAD SGVH2. entity 2
SNASKHGVGT ESLFFDKVRK ALRSAEAYEN FLRCLVIFNQ EVISRAELVQ LVSPFLGKFP ELFNWFKNFL GYKESSolvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1 mM | |
6 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
10 | entity_2 | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Solvent system 100% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | natural abundance | 1 mM | |
13 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1 mM | |
6 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
10 | entity_2 | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | natural abundance | 1 mM | |
13 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1 mM | |
6 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1 mM | |
6 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1 mM | |
6 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1 mM | |
6 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | entity_2 | natural abundance | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity_1 | natural abundance | 1 mM | |
6 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
10 | entity_2 | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | natural abundance | 1 mM | |
13 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
10 | entity_2 | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | natural abundance | 1 mM | |
13 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity_1 | [U-100% 13C; U-100% 15N] | 1 mM | |
10 | entity_2 | natural abundance | 1 mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | natural abundance | 1 mM | |
13 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17653_2ld7.nef |
Input source #2: Coordindates | 2ld7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---130-----140-------150-------160-------170-------180-------190-------200-------210-------220 SNAGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNAGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH --------10--------20--------30--------40--------50--------60--------70--------80--------90----
----460-------470-------480-------490-------500-------510-------520-------- SNASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKES ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKES --------10--------20--------30--------40--------50--------60--------70-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 94 | 0 | 0 | 100.0 |
B | B | 75 | 0 | 0 | 100.0 |
Content subtype: combined_17653_2ld7.nef
Assigned chemical shifts
---130-----140-------150-------160-------170-------180-------190-------200-------210-------220 SNAGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NAGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH
----460-------470-------480-------490-------500-------510-------520-------- SNASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKES |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKES
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
199 | CYS | HG | 5.98 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 566 | 483 | 85.3 |
13C chemical shifts | 417 | 379 | 90.9 |
15N chemical shifts | 104 | 94 | 90.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 189 | 178 | 94.2 |
13C chemical shifts | 188 | 184 | 97.9 |
15N chemical shifts | 89 | 85 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 377 | 305 | 80.9 |
13C chemical shifts | 229 | 195 | 85.2 |
15N chemical shifts | 15 | 9 | 60.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 48 | 100.0 |
13C chemical shifts | 48 | 48 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 17 | 51.5 |
13C chemical shifts | 33 | 0 | 0.0 |
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
486 | ARG | HH12 | 7.82 |
486 | ARG | HH11 | 5.99 |
486 | ARG | NH1 | 86.89 |
487 | CYS | HG | 3.11 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 485 | 423 | 87.2 |
13C chemical shifts | 366 | 320 | 87.4 |
15N chemical shifts | 85 | 79 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 152 | 148 | 97.4 |
13C chemical shifts | 150 | 145 | 96.7 |
15N chemical shifts | 73 | 71 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 333 | 275 | 82.6 |
13C chemical shifts | 216 | 175 | 81.0 |
15N chemical shifts | 12 | 8 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 40 | 100.0 |
13C chemical shifts | 40 | 40 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 36 | 59.0 |
13C chemical shifts | 60 | 21 | 35.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
---130-----140-------150-------160-------170-------180-------190-------200-------210-------220 SNAGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .N...DDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH
----460-------470-------480-------490-------500-------510-------520-------- SNASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKES | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .N.SKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKES
----460-------470-------480-------490-------500-------510-------520-------- SNASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKES ||||||||||||| ||||||||||||||| ||| ||| |||||||||| .........TESLFFDKVRKAL..AEAYENFLRCLVIFN.....RAE.VQL........PELFNWFKNF ----460-------470-------480-------490-------500-------510-------520--
Dihedral angle restraints
---130-----140-------150-------160-------170-------180-------190-------200-------210-------220 SNAGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH ||||||||||||||||||| |||||||||||||| ||||||||||||||| ...........................QVNTLRRYKRHFKLPTRPG.NKAQLVEIVGCHFK....NEKDTLTCFIYSVRN ---130-----140-------150-------160-------170-------180-------190-------200------
----460-------470-------480-------490-------500-------510-------520-------- SNASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKES |||||||||||||||||||||||||||||||| |||||||||||| |||||||||||| ........GTESLFFDKVRKALRSAEAYENFLRCLVIFNQ...SRAELVQLVSPF...FPELFNWFKNFL ----460-------470-------480-------490-------500-------510-------520---