Solution structure of the HMG box DNA-binding domain of human stem cell transcription factor Sox2
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.6 % (935 of 1032) | 86.3 % (483 of 560) | 95.1 % (370 of 389) | 98.8 % (82 of 83) |
Backbone | 83.6 % (398 of 476) | 60.4 % (96 of 159) | 93.8 % (226 of 241) | 100.0 % (76 of 76) |
Sidechain | 97.0 % (616 of 635) | 96.5 % (387 of 401) | 98.2 % (223 of 227) | 85.7 % (6 of 7) |
Aromatic | 91.7 % (66 of 72) | 97.2 % (35 of 36) | 88.2 % (30 of 34) | 50.0 % (1 of 2) |
Methyl | 100.0 % (52 of 52) | 100.0 % (26 of 26) | 100.0 % (26 of 26) |
1. Sox2
SDRVKRPMNA FMVWSRGQRR KMAQENPKMH NSEISKRLGA EWKLLSETEK RPFIDEAKRL RALHMKEHPD YKYRPRRKTK TSolvent system 95% H2O, 5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7, Details 0.7 mM nanog U-15N/13C, 10 mM MOPS, 5 mM Dithiothreitol, 100 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sox2 | [U-100% 13C; U-100% 15N] | 0.7 (±0.02) mM | |
2 | DTT | natural abundance | 5 (±0.05) % | |
3 | MOPS | natural abundance | 10 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian Inova - 600 MHz
State isotropic, Solvent system 95% H2O, 5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7, Details 0.7 mM nanog U-15N/13C, 10 mM MOPS, 5 mM Dithiothreitol, 100 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sox2 | [U-100% 13C; U-100% 15N] | 0.7 (±0.02) mM | |
2 | DTT | natural abundance | 5 (±0.05) % | |
3 | MOPS | natural abundance | 10 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 95% H2O, 5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7, Details 0.7 mM nanog U-15N/13C, 10 mM MOPS, 5 mM Dithiothreitol, 100 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sox2 | [U-100% 13C; U-100% 15N] | 0.7 (±0.02) mM | |
2 | DTT | natural abundance | 5 (±0.05) % | |
3 | MOPS | natural abundance | 10 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Varian Inova - 600 MHz
State isotropic, Solvent system 95% H2O, 5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.7, Details 0.7 mM nanog U-15N/13C, 10 mM MOPS, 5 mM Dithiothreitol, 100 mM NaCl
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sox2 | [U-100% 13C; U-100% 15N] | 0.7 (±0.02) mM | |
2 | DTT | natural abundance | 5 (±0.05) % | |
3 | MOPS | natural abundance | 10 mM | |
4 | NaCl | natural abundance | 100 mM | |
5 | H20 | natural abundance | 95 % | |
6 | D20 | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17691_2le4.nef |
Input source #2: Coordindates | 2le4.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80- SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 81 | 0 | 0 | 100.0 |
Content subtype: combined_17691_2le4.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80- SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
68 | HIS | HD1 | 7.963 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 560 | 469 | 83.8 |
13C chemical shifts | 389 | 370 | 95.1 |
15N chemical shifts | 95 | 80 | 84.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 159 | 81 | 50.9 |
13C chemical shifts | 162 | 147 | 90.7 |
15N chemical shifts | 76 | 75 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 401 | 388 | 96.8 |
13C chemical shifts | 227 | 223 | 98.2 |
15N chemical shifts | 19 | 5 | 26.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 31 | 100.0 |
13C chemical shifts | 31 | 31 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 34 | 94.4 |
13C chemical shifts | 34 | 30 | 88.2 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80- SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT
--------10--------20--------30--------40--------50--------60--------70--------80- SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT ||||||||||| ||| ||||||||||||| |||||||||||||| .........AFMVWSRGQRR.MAQ......NSEISKRLGAEWK.........FIDEAKRLRALHMK --------10--------20--------30--------40--------50--------60------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80- SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT