BMRBj - BMREntryMaster

Found 1 Document (0.769 seconds)

BMRB: 17719

2LEO

Solution structure of esophageal cancer-related gene 2

Authors

Feng, Y., Geng, Y., Wang, J.

Assembly

esophageal cancer-related gene 2

Entity

1. esophageal cancer-related gene 2 (polymer), 66 monomers, 7201.194 Da Detail

SEAASLSPKK VDCSIYKKYP VVAIPCPITY LPVCGSDYIT YGNECHLCTE SLKSNGRVQF LHDGSC

Formula weight

7201.194 Da

Entity Connection

disulfide 3 Detail

ID	Type	Value order	Atom ID 1	Atom ID 2
1	disulfide	sing	1:CYS13:SG	1:CYS48:SG
2	disulfide	sing	1:CYS26:SG	1:CYS45:SG
3	disulfide	sing	1:CYS34:SG	1:CYS66:SG

Source organism

Exptl. method

Refine. method

simulated annealing, molecular dynamics

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 100.0 %, Completeness: 98.6 %, Completeness (bb): 99.0 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	98.6 % (730 of 740)	99.0 % (378 of 382)	98.3 % (289 of 294)	98.4 % (63 of 64)
Backbone	99.0 % (382 of 386)	99.2 % (130 of 131)	99.0 % (192 of 194)	98.4 % (60 of 61)
Sidechain	98.6 % (410 of 416)	98.8 % (248 of 251)	98.1 % (159 of 162)	100.0 % (3 of 3)
Aromatic	93.1 % (54 of 58)	93.1 % (27 of 29)	93.1 % (27 of 29)
Methyl	100.0 % (68 of 68)	100.0 % (34 of 34)	100.0 % (34 of 34)

1. esophageal cancer-related gene 2

SEAASLSPKK VDCSIYKKYP VVAIPCPITY LPVCGSDYIT YGNECHLCTE SLKSNGRVQF LHDGSC

Show sample condition

Sample

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

LACS Plot; CA

Referencing offset: 0.01 ppm, Outliers: 1 Detail

LACS Plot; CB

Referencing offset: 0.01 ppm, Outliers: 1 Detail

LACS Plot; HA

Referencing offset: 0.06 ppm, Outliers: 1 Detail

LACS Plot; CO

Referencing offset: 0.52 ppm, Outliers: 3 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2LEO, Strand ID: A Detail

Release date

2012-05-08

Citation

NMR structure note: human esophageal cancer-related gene 2
Feng, Y., Geng, Y., Zhou, T., Wang, J.
J. Biomol. NMR (2012), 53, 65-70, PubMed 22528291 , DOI 10.1007/s10858-012-9622-9 , Abstract

Related entities 1. esophageal cancer-related gene 2, : 1 : 2 : 182 entities Detail

Interaction partners 1. esophageal cancer-related gene 2, : 7 interactors Detail

More details for 7 interactors identified by 1 citations

Experiments performed 12 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

2 2D 1H-13C HSQC

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

3 3D CBCA(CO)NH

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

4 3D HNCACB

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

5 3D HNCO

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

6 3D HN(CA)CO

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

7 3D HBHA(CO)NH

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

8 3D HCCH-TOCSY

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

9 3D CCH-TOCSY

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

10 3D 1H-15N TOCSY

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

11 3D 1H-15N NOESY

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

12 3D 1H-13C NOESY

Instrument

Bruker DMX - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 293 K, pH 5.0

#	Name	Isotope labeling	Type	Concentration
1	sodium acetate	[U-2H]		50 mM
2	potassium chloride	natural abundance		100 mM
3	DSS	natural abundance		0.01 %
4	sodium azide	natural abundance		0.01 %
5	EC-RG2	[U-13C; U-15N]		0.5 ~ 1.0 mM
6	H2O	natural abundance		90 %
7	D2O	natural abundance		10 %

NMR combined restraints 10 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_17719_2leo.nef
Input source #2: Coordindates	2leo.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	True (see coordinates for details)
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

Ptnr_site_1	Ptnr_site_2	Redox_state_prediction_1	Redox_state_prediction_2	Distance (Å)
A:32:CYS:SG	A:67:CYS:SG	oxidized, CA 53.4, CB 33.4 ppm	oxidized, CA 56.2, CB 35.1 ppm	2.031
A:45:CYS:SG	A:64:CYS:SG	oxidized, CA 49.9, CB 35.4 ppm	oxidized, CA 60.1, CB 35.4 ppm	2.034
A:53:CYS:SG	A:85:CYS:SG	oxidized, CA 54.5, CB 39.3 ppm	oxidized, CA 56.2, CB 38.9 ppm	2.02

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

20-------30--------40--------50--------60--------70--------80-----
SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC
--------10--------20--------30--------40--------50--------60------

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	66	0	0	100.0

Content subtype: combined_17719_2leo.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Covalent bonds	assembly	OK	3		No information
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	731		100.0 (chain: A, length: 66)
1	Distance restraints	CNS/XPLOR_distance_constraints_5	OK	387 (1)	noe	90.9 (chain: A, length: 66)
2	Distance restraints	CNS/XPLOR_distance_constraints_3	OK	204 (1)	noe	89.4 (chain: A, length: 66)
3	Distance restraints	CNS/XPLOR_distance_constraints_7	Warning	28 (1)	noe	19.7 (chain: A, length: 66)
4	Distance restraints	CNS/XPLOR_distance_constraints_2	OK	838 (1)	noe	100.0 (chain: A, length: 66)
5	Distance restraints	CNS/XPLOR_distance_constraints_6	OK	82 (1)	noe	37.9 (chain: A, length: 66)
6	Distance restraints	CNS/XPLOR_distance_constraints_4	OK	1377 (1)	noe	100.0 (chain: A, length: 66)
7	Distance restraints	CNS/XPLOR_distance_constraints_8	OK	26 (1)	hbond	30.3 (chain: A, length: 66)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_9	OK	94 (94)	.	86.4 (chain: A, length: 66)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 66, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 378
  - ¹³C chemical shifts: 289
  - ¹⁵N chemical shifts: 64
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Covalent bonds

Saveframe: assembly
- Status: OK

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_5
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 66, Sequence coverage: 90.9%
- Total number of restraints: 382
- Weight of restraints: 1.0 (382)
- Potential type of restraints: square-well-parabolic (382)
- Range of distance target values: 2.3, 3.65 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_3
  - Status: OK
  - Experiment type: noe
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 66, Sequence coverage: 89.4%
  - Total number of restraints: 203
  - Weight of restraints: 1.0 (203)
  - Potential type of restraints: square-well-parabolic (203)
  - Range of distance target values: 2.3, 4.15 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map
  - Saveframe: CNS/XPLOR_distance_constraints_7
    - Status: Warning
    - Experiment type: noe
    - Sequence coverage of experimental data
      - Entity_assembly_ID: A, Chain length: 66, Sequence coverage: 19.7%
    - Total number of restraints: 27
    - Weight of restraints: 1.0 (27)
    - Potential type of restraints: square-well-parabolic (27)
    - Range of distance target values: 2.3, 3.65 (Å)
    - Histogram of distance target values
    - Distance restraints per residue
      - Chain_ID: A
    - Distance restraints on contact map
    - Saveframe: CNS/XPLOR_distance_constraints_2
      - Status: OK
      - Experiment type: noe
      - Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 66, Sequence coverage: 100.0%
        20-------30--------40--------50--------60--------70--------80----- SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC
      - Total number of restraints: 838
        Intra-residue restraints, i = j : 204
        Sequential restraints, | i - j | = 1 : 302
        Backbone-backbone: 154
        Backbone-side chain: 148
        Medium range restraints, 1 < | i - j | < 5 : 145
        Backbone-backbone: 76
        Backbone-side chain: 67
        Side chain-side chain: 2
        Long range restraints, | i - j | >= 5 : 187
      - Weight of restraints: 1.0 (838)
        Intra-residue restraints, i = j : 1.0 (204)
        Sequential restraints, | i - j | = 1 : 1.0 (302)
        Backbone-backbone: 1.0 (154)
        Backbone-side chain: 1.0 (148)
        Medium range restraints, 1 < | i - j | < 5 : 1.0 (145)
        Backbone-backbone: 1.0 (76)
        Backbone-side chain: 1.0 (67)
        Side chain-side chain: 1.0 (2)
        Long range restraints, | i - j | >= 5 : 1.0 (187)
      - Potential type of restraints: square-well-parabolic (838)
        Intra-residue restraints, i = j : square-well-parabolic (204)
        Sequential restraints, | i - j | = 1 : square-well-parabolic (302)
        Backbone-backbone: square-well-parabolic (154)
        Backbone-side chain: square-well-parabolic (148)
        Medium range restraints, 1 < | i - j | < 5 : square-well-parabolic (145)
        Backbone-backbone: square-well-parabolic (76)
        Backbone-side chain: square-well-parabolic (67)
        Side chain-side chain: square-well-parabolic (2)
        Long range restraints, | i - j | >= 5 : square-well-parabolic (187)
      - Range of distance target values: 2.3, 4.15 (Å)
      - Histogram of distance target values
      - Histogram of discrepancy in distance target values
      - Distance restraints per residue
        Chain_ID: A
      - Distance restraints on contact map
        Chain_ID_1: A - Chain_ID_2: A
      - Saveframe: CNS/XPLOR_distance_constraints_6
        Status: OK
        Experiment type: noe
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 66, Sequence coverage: 37.9%
        Total number of restraints: 82
        Intra-residue restraints, i = j : 34
        Sequential restraints, | i - j | = 1 : 10
        Backbone-side chain: 2
        Side chain-side chain: 8
        Medium range restraints, 1 < | i - j | < 5 : 13
        Backbone-side chain: 9
        Side chain-side chain: 4
        Long range restraints, | i - j | >= 5 : 25
        Weight of restraints: 1.0 (82)
        Intra-residue restraints, i = j : 1.0 (34)
        Sequential restraints, | i - j | = 1 : 1.0 (10)
        Backbone-side chain: 1.0 (2)
        Side chain-side chain: 1.0 (8)
        Medium range restraints, 1 < | i - j | < 5 : 1.0 (13)
        Backbone-side chain: 1.0 (9)
        Side chain-side chain: 1.0 (4)
        Long range restraints, | i - j | >= 5 : 1.0 (25)
        Potential type of restraints: square-well-parabolic (82)
        Intra-residue restraints, i = j : square-well-parabolic (34)
        Sequential restraints, | i - j | = 1 : square-well-parabolic (10)
        Backbone-side chain: square-well-parabolic (2)
        Side chain-side chain: square-well-parabolic (8)
        Medium range restraints, 1 < | i - j | < 5 : square-well-parabolic (13)
        Backbone-side chain: square-well-parabolic (9)
        Side chain-side chain: square-well-parabolic (4)
        Long range restraints, | i - j | >= 5 : square-well-parabolic (25)
        Range of distance target values: 2.3, 4.15 (Å)
        Histogram of distance target values
        Histogram of discrepancy in distance target values
        Distance restraints per residue
        Chain_ID: A
        Distance restraints on contact map
        Saveframe: CNS/XPLOR_distance_constraints_4
        Status: OK
        Experiment type: noe
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 66, Sequence coverage: 100.0%
        20-------30--------40--------50--------60--------70--------80----- SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC
        Total number of restraints: 1372
        Intra-residue restraints, i = j : 735
        Sequential restraints, | i - j | = 1 : 213
        Backbone-backbone: 51
        Backbone-side chain: 127
        Side chain-side chain: 35
        Medium range restraints, 1 < | i - j | < 5 : 126
        Backbone-backbone: 11
        Backbone-side chain: 66
        Side chain-side chain: 49
        Long range restraints, | i - j | >= 5 : 298
        Weight of restraints: 1.0 (1372)
        Intra-residue restraints, i = j : 1.0 (735)
        Sequential restraints, | i - j | = 1 : 1.0 (213)
        Backbone-backbone: 1.0 (51)
        Backbone-side chain: 1.0 (127)
        Side chain-side chain: 1.0 (35)
        Medium range restraints, 1 < | i - j | < 5 : 1.0 (126)
        Backbone-backbone: 1.0 (11)
        Backbone-side chain: 1.0 (66)
        Side chain-side chain: 1.0 (49)
        Long range restraints, | i - j | >= 5 : 1.0 (298)
        Potential type of restraints: square-well-parabolic (1372)
        Intra-residue restraints, i = j : square-well-parabolic (735)
        Sequential restraints, | i - j | = 1 : square-well-parabolic (213)
        Backbone-backbone: square-well-parabolic (51)
        Backbone-side chain: square-well-parabolic (127)
        Side chain-side chain: square-well-parabolic (35)
        Medium range restraints, 1 < | i - j | < 5 : square-well-parabolic (126)
        Backbone-backbone: square-well-parabolic (11)
        Backbone-side chain: square-well-parabolic (66)
        Side chain-side chain: square-well-parabolic (49)
        Long range restraints, | i - j | >= 5 : square-well-parabolic (298)
        Range of distance target values: 2.3, 4.15 (Å)
        Histogram of distance target values
        Histogram of discrepancy in distance target values
        Distance restraints per residue
        Chain_ID: A
        Distance restraints on contact map
        Chain_ID_1: A - Chain_ID_2: A
        Saveframe: CNS/XPLOR_distance_constraints_8
        Status: OK
        Experiment type: hbond
        Sequence coverage of experimental data
        Entity_assembly_ID: A, Chain length: 66, Sequence coverage: 30.3%
        Total number of restraints: 26
        Total hydrogen bond restraints: 26
        O...H-x: 8
        O...h-N: 8
        Long range: 10
        O...H-x: 5
        O...h-N: 5
        Weight of restraints: 1.0 (26)
        Total hydrogen bond restraints: 1.0 (26)
        O...H-x: 1.0 (8)
        O...h-N: 1.0 (8)
        Long range: 1.0 (10)
        O...H-x: 1.0 (5)
        O...h-N: 1.0 (5)
        Potential type of restraints: square-well-parabolic (26)
        Total hydrogen bond restraints: square-well-parabolic (26)
        O...H-x: square-well-parabolic (8)
        O...h-N: square-well-parabolic (8)
        Long range: square-well-parabolic (10)
        O...H-x: square-well-parabolic (5)
        O...h-N: square-well-parabolic (5)
        Range of distance target values: 2.0, 3.0 (Å)
        Histogram of distance target values
        Distance restraints per residue
        Chain_ID: A
        Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_9
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 66, Sequence coverage: 86.4%
- Total number of restraints: 94
- Total number of restraints per polymer type: 94
- Weight of restraints: 1.0 (94)
- Potential type of restraints: square-well-parabolic (94)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords esophageal cancer-related gene 2, Protease Inhibitor