Chemical Shift Assignment and Solution Structure of ChR145 from Cytophaga Hutchinsonii. Northeast Structural Genomics Consortium Target ChR145.
MEIKLIAQVK TVINAPIEKV WEALVNPEII KEYMFGTTVV SDWKEGSQIV WKGEWKGKAY EDKGTILQFN ERSILQYSHF SPLTGKPDLP ENYHVVTITL TALKKGVEVE LTQDNNETEK EQKHSEDNWN TMLEGLKKFL ENKVSA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.5 % (1559 of 1781) | 84.8 % (788 of 929) | 89.6 % (619 of 691) | 94.4 % (152 of 161) |
Backbone | 98.7 % (855 of 866) | 98.0 % (289 of 295) | 99.1 % (426 of 430) | 99.3 % (140 of 141) |
Sidechain | 79.9 % (841 of 1053) | 78.7 % (499 of 634) | 82.7 % (330 of 399) | 60.0 % (12 of 20) |
Aromatic | 52.1 % (75 of 144) | 59.7 % (43 of 72) | 40.3 % (27 of 67) | 100.0 % (5 of 5) |
Methyl | 86.5 % (147 of 170) | 88.2 % (75 of 85) | 84.7 % (72 of 85) |
1. ChR145
MEIKLIAQVK TVINAPIEKV WEALVNPEII KEYMFGTTVV SDWKEGSQIV WKGEWKGKAY EDKGTILQFN ERSILQYSHF SPLTGKPDLP ENYHVVTITL TALKKGVEVE LTQDNNETEK EQKHSEDNWN TMLEGLKKFL ENKVSASolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample Phage RDC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ChR145 | [U-100% 13C; U-100% 15N] | 0.57 mM | |
10 | sodium azide | natural abundance | 0.2 % | |
11 | DTT | natural abundance | 5 mM | |
12 | CaCl2 | natural abundance | 5 mM | |
13 | sodium chloride | natural abundance | 200 mM | |
14 | MES | natural abundance | 20 mM | |
15 | Pf1 phage | natural abundance | 12.5 mg | |
16 | H2O | natural abundance | 95 % | |
17 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample Peg RDC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | ChR145 | [U-100% 13C; U-100% 15N] | 0.57 mM | |
19 | sodium azide | natural abundance | 0.2 % | |
20 | DTT | natural abundance | 5 mM | |
21 | CaCl2 | natural abundance | 5 mM | |
22 | sodium chloride | natural abundance | 200 mM | |
23 | MES | natural abundance | 20 mM | |
24 | C12E5/Hexanol | natural abundance | 4 % | |
25 | H2O | natural abundance | 95 % | |
26 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for Neutral Stretch Gel RDC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
27 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
28 | sodium azide | natural abundance | 0.2 % | |
29 | DTT | natural abundance | 5 mM | |
30 | CaCl2 | natural abundance | 5 mM | |
31 | sodium chloride | natural abundance | 200 mM | |
32 | MES | natural abundance | 20 mM | |
33 | Polyacrylamide | natural abundance | 5 % | |
34 | H2O | natural abundance | 95 % | |
35 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 K, pH 6.5
Experiment name NC J-Modulation, NH J-Modulation
List #1 NH_Phage, RDC code DNH, Field strength (1H) 600 MHz
List #3 NH_Peg, RDC code DNH, Field strength (1H) 600 MHz
List #5 NH_GEL, RDC code DNH, Field strength (1H) 600 MHz, Details NH RDC of neutral stretch gel
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for 3D experiments
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | sodium azide | natural abundance | 0.2 % | |
3 | DTT | natural abundance | 5 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM | |
6 | MES | natural abundance | 20 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample Phage RDC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ChR145 | [U-100% 13C; U-100% 15N] | 0.57 mM | |
10 | sodium azide | natural abundance | 0.2 % | |
11 | DTT | natural abundance | 5 mM | |
12 | CaCl2 | natural abundance | 5 mM | |
13 | sodium chloride | natural abundance | 200 mM | |
14 | MES | natural abundance | 20 mM | |
15 | Pf1 phage | natural abundance | 12.5 mg | |
16 | H2O | natural abundance | 95 % | |
17 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample Peg RDC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | ChR145 | [U-100% 13C; U-100% 15N] | 0.57 mM | |
19 | sodium azide | natural abundance | 0.2 % | |
20 | DTT | natural abundance | 5 mM | |
21 | CaCl2 | natural abundance | 5 mM | |
22 | sodium chloride | natural abundance | 200 mM | |
23 | MES | natural abundance | 20 mM | |
24 | C12E5/Hexanol | natural abundance | 4 % | |
25 | H2O | natural abundance | 95 % | |
26 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample for Neutral Stretch Gel RDC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
27 | ChR145 | [U-100% 13C; U-100% 15N] | 0.85 mM | |
28 | sodium azide | natural abundance | 0.2 % | |
29 | DTT | natural abundance | 5 mM | |
30 | CaCl2 | natural abundance | 5 mM | |
31 | sodium chloride | natural abundance | 200 mM | |
32 | MES | natural abundance | 20 mM | |
33 | Polyacrylamide | natural abundance | 5 % | |
34 | H2O | natural abundance | 95 % | |
35 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample Phage RDC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ChR145 | [U-100% 13C; U-100% 15N] | 0.57 mM | |
10 | sodium azide | natural abundance | 0.2 % | |
11 | DTT | natural abundance | 5 mM | |
12 | CaCl2 | natural abundance | 5 mM | |
13 | sodium chloride | natural abundance | 200 mM | |
14 | MES | natural abundance | 20 mM | |
15 | Pf1 phage | natural abundance | 12.5 mg | |
16 | H2O | natural abundance | 95 % | |
17 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details Solution sample Peg RDC
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | ChR145 | [U-100% 13C; U-100% 15N] | 0.57 mM | |
19 | sodium azide | natural abundance | 0.2 % | |
20 | DTT | natural abundance | 5 mM | |
21 | CaCl2 | natural abundance | 5 mM | |
22 | sodium chloride | natural abundance | 200 mM | |
23 | MES | natural abundance | 20 mM | |
24 | C12E5/Hexanol | natural abundance | 4 % | |
25 | H2O | natural abundance | 95 % | |
26 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17723_2leq.nef |
Input source #2: Coordindates | 2leq.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEIKLIAQVKTVINAPIEKVWEALVNPEIIKEYMFGTTVVSDWKEGSQIVWKGEWKGKAYEDKGTILQFNERSILQYSHFSPLTGKPDLPENYHVVTITL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEIKLIAQVKTVINAPIEKVWEALVNPEIIKEYMFGTTVVSDWKEGSQIVWKGEWKGKAYEDKGTILQFNERSILQYSHFSPLTGKPDLPENYHVVTITL -------110-------120-------130-------140------ TALKKGVEVELTQDNNETEKEQKHSEDNWNTMLEGLKKFLENKVSA |||||||||||||||||||||||||||||||||||||||||||||| TALKKGVEVELTQDNNETEKEQKHSEDNWNTMLEGLKKFLENKVSA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 146 | 0 | 0 | 100.0 |
Content subtype: combined_17723_2leq.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEIKLIAQVKTVINAPIEKVWEALVNPEIIKEYMFGTTVVSDWKEGSQIVWKGEWKGKAYEDKGTILQFNERSILQYSHFSPLTGKPDLPENYHVVTITL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EIKLIAQVKTVINAPIEKVWEALVNPEIIKEYMFGTTVVSDWKEGSQIVWKGEWKGKAYEDKGTILQFNERSILQYSHFSPLTGKPDLPENYHVVTITL -------110-------120-------130-------140------ TALKKGVEVELTQDNNETEKEQKHSEDNWNTMLEGLKKFLENKVSA |||||||||||||||||||||||||||||||||||||||||||||| TALKKGVEVELTQDNNETEKEQKHSEDNWNTMLEGLKKFLENKVSA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 929 | 787 | 84.7 |
13C chemical shifts | 691 | 616 | 89.1 |
15N chemical shifts | 162 | 152 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 295 | 293 | 99.3 |
13C chemical shifts | 292 | 289 | 99.0 |
15N chemical shifts | 141 | 140 | 99.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 634 | 494 | 77.9 |
13C chemical shifts | 399 | 327 | 82.0 |
15N chemical shifts | 21 | 12 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 88 | 72 | 81.8 |
13C chemical shifts | 88 | 69 | 78.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 45 | 62.5 |
13C chemical shifts | 67 | 27 | 40.3 |
15N chemical shifts | 5 | 5 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEIKLIAQVKTVINAPIEKVWEALVNPEIIKEYMFGTTVVSDWKEGSQIVWKGEWKGKAYEDKGTILQFNERSILQYSHFSPLTGKPDLPENYHVVTITL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EIKLIAQVKTVINAPIEKVWEALVNPEIIKEYMFGTTVVSDWKEGSQIVWKGEWKGKAYEDKGTILQFNERSILQYSHFSPLTGKPDLPENYHVVTITL -------110-------120-------130-------140------ TALKKGVEVELTQDNNETEKEQKHSEDNWNTMLEGLKKFLENKVSA |||||||||||||||||||||||||||||||||||||||||||||| TALKKGVEVELTQDNNETEKEQKHSEDNWNTMLEGLKKFLENKVSA
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEIKLIAQVKTVINAPIEKVWEALVNPEIIKEYMFGTTVVSDWKEGSQIVWKGEWKGKAYEDKGTILQFNERSILQYSHFSPLTGKPDLPENYHVVTITL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..IKLIAQVKTVINAPIEKVWEALVNPEIIKEYMFGTTVVSDWKEGSQIVWKGEWKGKAYEDKGTILQFNERSILQYSHFSPLTGKPDLPENYHVVTITL -------110-------120-------130-------140------ TALKKGVEVELTQDNNETEKEQKHSEDNWNTMLEGLKKFLENKVSA |||||||||||||||||||||||||||||||||||||||||||||| TALKKGVEVELTQDNNETEKEQKHSEDNWNTMLEGLKKFLENKVSA