Solution structure of the chimeric Af1503 HAMP- EnvZ DHp homodimer
MSTITRPIIE LSNTADKIAE GNLEAEVPHQ NRADEIGILA KSIERLRRSL KQLADDRTLL MAGVSHDLRT PLTRIRLATE MMSEQDGYLA ESINKDIEEC NAIIEQFIDY LR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.4 % (1196 of 1294) | 91.4 % (618 of 676) | 93.4 % (467 of 500) | 94.1 % (111 of 118) |
Backbone | 95.0 % (633 of 666) | 95.6 % (215 of 225) | 95.2 % (316 of 332) | 93.6 % (102 of 109) |
Sidechain | 90.8 % (668 of 736) | 89.4 % (403 of 451) | 92.8 % (256 of 276) | 100.0 % (9 of 9) |
Aromatic | 64.7 % (22 of 34) | 100.0 % (17 of 17) | 29.4 % (5 of 17) | |
Methyl | 97.3 % (142 of 146) | 97.3 % (71 of 73) | 97.3 % (71 of 73) |
1. HAMP-DHp
MSTITRPIIE LSNTADKIAE GNLEAEVPHQ NRADEIGILA KSIERLRRSL KQLADDRTLL MAGVSHDLRT PLTRIRLATE MMSEQDGYLA ESINKDIEEC NAIIEQFIDY LRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HAMP-DHp | [U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 12 mM | |
3 | sodium chloride | natural abundance | 138 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHp | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHp | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHp | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHp | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHp | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HAMP-DHp | [U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 12 mM | |
3 | sodium chloride | natural abundance | 138 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HAMP-DHp | [U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 12 mM | |
3 | sodium chloride | natural abundance | 138 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHp | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHp | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHp | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHp | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HAMP-DHp | [U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 12 mM | |
3 | sodium chloride | natural abundance | 138 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HAMP-DHp | [U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 12 mM | |
3 | sodium chloride | natural abundance | 138 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17775_2lfr.nef |
Input source #2: Coordindates | 2lfr.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---380-------- ECNAIIEQFIDYLR |||||||||||||| ECNAIIEQFIDYLR -------110----
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---380-------- ECNAIIEQFIDYLR |||||||||||||| ECNAIIEQFIDYLR -------110----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 114 | 0 | 0 | 100.0 |
B | B | 114 | 0 | 0 | 100.0 |
Content subtype: combined_17775_2lfr.nef
Assigned chemical shifts
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....IT.PIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ---380-------- ECNAIIEQFIDYLR |||||||||||||| ECNAIIEQFIDYLR
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
305 | HIS | HD1 | 7.81 |
305 | HIS | ND1 | 138.12 |
355 | THR | HG1 | 6.09 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 684 | 608 | 88.9 |
13C chemical shifts | 508 | 456 | 89.8 |
15N chemical shifts | 130 | 111 | 85.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 229 | 212 | 92.6 |
13C chemical shifts | 228 | 205 | 89.9 |
15N chemical shifts | 111 | 100 | 90.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 455 | 396 | 87.0 |
13C chemical shifts | 280 | 251 | 89.6 |
15N chemical shifts | 19 | 11 | 57.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 79 | 74 | 93.7 |
13C chemical shifts | 79 | 74 | 93.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 17 | 100.0 |
13C chemical shifts | 17 | 5 | 29.4 |
Distance restraints
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ||||||||||||||||||||||||||||||||||||||||||||||||||||| | || ||| | ||||||||||||||||||||||||||| ....TITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLAD..T.LM.GVS..L..PLTRIRLATEMMSEQDGYLAESINKDI. ---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- ---380-------- ECNAIIEQFIDYLR | || | .C..II..F ---380---
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ||||||||||||||||||||||||||||||||||||||||||||||||||||| | || ||| | ||||||||||||||||||||||||||| ....TITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLAD..T.LM.GVS..L..PLTRIRLATEMMSEQDGYLAESINKDI. ---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- ---380-------- ECNAIIEQFIDYLR | || | .C..II..F ---380---
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ||||||||||||||| | ||||||||||||||||||||||||||||||||||||||||||||| ||||||||| .........IIELSNTADKIAEGN.........R.DEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLA...........AESINKDIE ---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- ---380-------- ECNAIIEQFIDYLR ||||||||||||| ECNAIIEQFIDYL ---380-------
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ||||||||||||||| | ||||||||||||||||||||||||||||||||||||||||||||| ||||||||| .........IIELSNTADKIAEGN.........R.DEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLA...........AESINKDIE ---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- ---380-------- ECNAIIEQFIDYLR ||||||||||||| ECNAIIEQFIDYL ---380-------
Dihedral angle restraints
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ---380-------- ECNAIIEQFIDYLR |||||||||||||| ECNAIIEQFIDYLR
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ---380-------- ECNAIIEQFIDYLR |||||||||||||| ECNAIIEQFIDYLR