Solution structure of the chimeric Af1503 HAMP- EnvZ DHp homodimer; A219F variant
MSTITRPIIE LSNTFDKIAE GNLEAEVPHQ NRADEIGILA KSIERLRRSL KQLADDRTLL MAGVSHDLRT PLTRIRLATE MMSEQDGYLA ESINKDIEEC NAIIEQFIDY LR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.5 % (1025 of 1305) | 77.1 % (526 of 682) | 78.6 % (397 of 505) | 86.4 % (102 of 118) |
Backbone | 85.0 % (566 of 666) | 85.3 % (192 of 225) | 84.3 % (280 of 332) | 86.2 % (94 of 109) |
Sidechain | 74.2 % (554 of 747) | 73.1 % (334 of 457) | 75.4 % (212 of 281) | 88.9 % (8 of 9) |
Aromatic | 38.6 % (17 of 44) | 77.3 % (17 of 22) | 0.0 % (0 of 22) | |
Methyl | 81.3 % (117 of 144) | 79.2 % (57 of 72) | 83.3 % (60 of 72) |
1. HAMP-DHpF
MSTITRPIIE LSNTFDKIAE GNLEAEVPHQ NRADEIGILA KSIERLRRSL KQLADDRTLL MAGVSHDLRT PLTRIRLATE MMSEQDGYLA ESINKDIEEC NAIIEQFIDY LRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HAMP-DHpF | [U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 12 mM | |
3 | sodium chloride | natural abundance | 138 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHpF | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHpF | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHpF | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHpF | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHpF | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HAMP-DHpF | [U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 12 mM | |
3 | sodium chloride | natural abundance | 138 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HAMP-DHpF | [U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 12 mM | |
3 | sodium chloride | natural abundance | 138 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHpF | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHpF | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHpF | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HAMP-DHpF | [U-100% 13C; U-100% 15N] | 0.6 mM | |
7 | phosphate buffer | natural abundance | 12 mM | |
8 | sodium chloride | natural abundance | 138 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HAMP-DHpF | [U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 12 mM | |
3 | sodium chloride | natural abundance | 138 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HAMP-DHpF | [U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 12 mM | |
3 | sodium chloride | natural abundance | 138 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HAMP-DHpF | [U-100% 15N] | 0.6 mM | |
2 | phosphate buffer | natural abundance | 12 mM | |
3 | sodium chloride | natural abundance | 138 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, RDC restraints | combined_17776_2lfs.nef |
Input source #2: Coordindates | 2lfs.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTTSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---380-------- ECNAIIEQFIDYLR |||||||||||||| ECNAIIEQFIDYLR -------110----
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTTSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---380-------- ECNAIIEQFIDYLR |||||||||||||| ECNAIIEQFIDYLR -------110----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 114 | 0 | 0 | 100.0 |
B | B | 114 | 0 | 0 | 100.0 |
Content subtype: combined_17776_2lfs.nef
Assigned chemical shifts
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE |||||||||||||||||||||||||| ||||| ||||||||||||| ....................................................KQLADDRTLLMAGVSHDLRTPLTRIR.ATEMM...DGYLAESINKDIE ---380-------- ECNAIIEQFIDYLR ||||| |||||||| ECNAI.EQFIDYLR
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
355 | THR | HG1 | 6.13 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 690 | 253 | 36.7 |
13C chemical shifts | 513 | 207 | 40.4 |
15N chemical shifts | 130 | 57 | 43.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 229 | 107 | 46.7 |
13C chemical shifts | 228 | 99 | 43.4 |
15N chemical shifts | 111 | 53 | 47.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 461 | 146 | 31.7 |
13C chemical shifts | 285 | 108 | 37.9 |
15N chemical shifts | 19 | 4 | 21.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 29 | 37.2 |
13C chemical shifts | 78 | 32 | 41.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 10 | 45.5 |
13C chemical shifts | 22 | 0 | 0.0 |
Distance restraints
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....ITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ---380-------- ECNAIIEQFIDYLR |||||||||||||| ECNAIIEQFIDYLR
---280-------290-------300-------310-------320-------330-------340-------350-------360-------370---- MTTSTITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....ITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIE ---380-------- ECNAIIEQFIDYLR |||||||||||||| ECNAIIEQFIDYLR
RDC restraints