Solution Structure of the SPOR domain from E. coli DamX
MRGSHHHHHH GSNNNGSLKS APSSHYTLQL SSSSNYDNLN GWAKKENLKN YVVYETTRNG QPWYVLVSGV YASKEEAKKA VSTLPADVQA KNPWAKPLRQ VQADLK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.1 % (1156 of 1229) | 93.8 % (601 of 641) | 94.5 % (443 of 469) | 94.1 % (112 of 119) |
Backbone | 93.3 % (584 of 626) | 92.5 % (197 of 213) | 93.9 % (293 of 312) | 93.1 % (94 of 101) |
Sidechain | 95.0 % (668 of 703) | 94.4 % (404 of 428) | 95.7 % (246 of 257) | 100.0 % (18 of 18) |
Aromatic | 95.5 % (107 of 112) | 100.0 % (56 of 56) | 90.6 % (48 of 53) | 100.0 % (3 of 3) |
Methyl | 100.0 % (94 of 94) | 100.0 % (47 of 47) | 100.0 % (47 of 47) |
1. DamX SPOR domain polypeptide
MRGSHHHHHH GSNNNGSLKS APSSHYTLQL SSSSNYDNLN GWAKKENLKN YVVYETTRNG QPWYVLVSGV YASKEEAKKA VSTLPADVQA KNPWAKPLRQ VQADLKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DamX SPOR domain polypeptide | [U-99% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | potassium phosphate | natural abundance | 50 mM | |
5 | potassium chloride | natural abundance | 50 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | D2O | [U-99% 2H] | 100 % | |
8 | potassium phosphate | natural abundance | 50 mM | |
9 | potassium chloride | natural abundance | 50 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-99% 2H] | 10 % | |
13 | potassium phosphate | natural abundance | 50 mM | |
14 | potassium chloride | natural abundance | 50 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | DamX SPOR domain polypeptide | [U-99% 15N] | 0.7 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | [U-99% 2H] | 10 % | |
18 | potassium phosphate | natural abundance | 50 mM | |
19 | potassium chloride | natural abundance | 50 mM | |
20 | PEG(C12E5):n-hexanol | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 K, pH 6.5
Experiment name 2D 15N T1
Pressure 1 atm, Temperature 298 K, pH 6.5
Experiment name 2D 15N T2
Pressure 1 atm, Temperature 298 K, pH 6.5
Experiment name 2D {1H}-15N NOE
Pressure 1 atm, Temperature 298 K, pH 6.5
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DamX SPOR domain polypeptide | [U-99% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | potassium phosphate | natural abundance | 50 mM | |
5 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | D2O | [U-99% 2H] | 100 % | |
8 | potassium phosphate | natural abundance | 50 mM | |
9 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-99% 2H] | 10 % | |
13 | potassium phosphate | natural abundance | 50 mM | |
14 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-99% 2H] | 10 % | |
13 | potassium phosphate | natural abundance | 50 mM | |
14 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-99% 2H] | 10 % | |
13 | potassium phosphate | natural abundance | 50 mM | |
14 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-99% 2H] | 10 % | |
13 | potassium phosphate | natural abundance | 50 mM | |
14 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-99% 2H] | 10 % | |
13 | potassium phosphate | natural abundance | 50 mM | |
14 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-99% 2H] | 10 % | |
13 | potassium phosphate | natural abundance | 50 mM | |
14 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DamX SPOR domain polypeptide | [U-99% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | potassium phosphate | natural abundance | 50 mM | |
5 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DamX SPOR domain polypeptide | [U-99% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | potassium phosphate | natural abundance | 50 mM | |
5 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | D2O | [U-99% 2H] | 100 % | |
8 | potassium phosphate | natural abundance | 50 mM | |
9 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | D2O | [U-99% 2H] | 100 % | |
8 | potassium phosphate | natural abundance | 50 mM | |
9 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | D2O | [U-99% 2H] | 100 % | |
8 | potassium phosphate | natural abundance | 50 mM | |
9 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-99% 2H] | 10 % | |
13 | potassium phosphate | natural abundance | 50 mM | |
14 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-99% 2H] | 10 % | |
13 | potassium phosphate | natural abundance | 50 mM | |
14 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | D2O | [U-99% 2H] | 100 % | |
8 | potassium phosphate | natural abundance | 50 mM | |
9 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | D2O | [U-99% 2H] | 100 % | |
8 | potassium phosphate | natural abundance | 50 mM | |
9 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | D2O | [U-99% 2H] | 100 % | |
8 | potassium phosphate | natural abundance | 50 mM | |
9 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | [U-99% 2H] | 10 % | |
13 | potassium phosphate | natural abundance | 50 mM | |
14 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DamX SPOR domain polypeptide | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | D2O | [U-99% 2H] | 100 % | |
8 | potassium phosphate | natural abundance | 50 mM | |
9 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DamX SPOR domain polypeptide | [U-99% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | potassium phosphate | natural abundance | 50 mM | |
5 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | DamX SPOR domain polypeptide | [U-99% 15N] | 0.7 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | [U-99% 2H] | 10 % | |
18 | potassium phosphate | natural abundance | 50 mM | |
19 | potassium chloride | natural abundance | 50 mM | |
20 | PEG(C12E5):n-hexanol | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DamX SPOR domain polypeptide | [U-99% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | potassium phosphate | natural abundance | 50 mM | |
5 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DamX SPOR domain polypeptide | [U-99% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | potassium phosphate | natural abundance | 50 mM | |
5 | potassium chloride | natural abundance | 50 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DamX SPOR domain polypeptide | [U-99% 15N] | 0.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | [U-99% 2H] | 10 % | |
4 | potassium phosphate | natural abundance | 50 mM | |
5 | potassium chloride | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17783_2lfv.nef |
Input source #2: Coordindates | 2lfv.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----330-------340-------350-------360-------370-------380-------390-------400-------410-------420-- MRGSHHHHHHGSNNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRGSHHHHHHGSNNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------ VQADLK |||||| VQADLK ------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_17783_2lfv.nef
Assigned chemical shifts
-----330-------340-------350-------360-------370-------380-------390-------400-------410-------420-- MRGSHHHHHHGSNNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRGSHHHHHHGSNNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQ ------ VQADLK |||||| VQADLK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
335 | ASN | CG | 177.133 |
336 | ASN | CG | 177.133 |
357 | ASN | CG | 176.461 |
360 | ASN | CG | 175.344 |
369 | ASN | CG | 178.198 |
372 | ASN | CG | 177.821 |
381 | ASN | CG | 177.94 |
383 | GLN | CD | 180.596 |
405 | THR | HG1 | 4.969 |
414 | ASN | CG | 177.848 |
422 | GLN | CD | 179.379 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 641 | 617 | 96.3 |
13C chemical shifts | 469 | 447 | 95.3 |
15N chemical shifts | 122 | 114 | 93.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 213 | 201 | 94.4 |
13C chemical shifts | 212 | 201 | 94.8 |
15N chemical shifts | 101 | 94 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 428 | 416 | 97.2 |
13C chemical shifts | 257 | 246 | 95.7 |
15N chemical shifts | 21 | 20 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 47 | 97.9 |
13C chemical shifts | 48 | 47 | 97.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 56 | 100.0 |
13C chemical shifts | 53 | 48 | 90.6 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
-----330-------340-------350-------360-------370-------380-------390-------400-------410-------420-- MRGSHHHHHHGSNNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQ ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .RGS........NNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQ ------ VQADLK |||||| VQADLK
-----330-------340-------350-------360-------370-------380-------390-------400-------410-------420-- MRGSHHHHHHGSNNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQ |||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRGS....HHGSNNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQ ------ VQADLK |||||| VQADLK
Dihedral angle restraints
-----330-------340-------350-------360-------370-------380-------390-------400-------410-------420-- MRGSHHHHHHGSNNNGSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...............GSLKSAPSSHYTLQLSSSSNYDNLNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPLRQ ------ VQADLK |||||| VQADLK