NMR structure of the calcium-bound form of the protein YP_001302112.1 from Parabacteroides distasonis
KDDDEPGGKG AMYEVTIEQS GDFRSFIKSV VVVANGTQLK DGATGESLAS PVILSDEELA VEKVTLSTTG KAIEFAVSGG VVDGEDGVVN EPMQWVVTVY KNGKEIEKKS LVFRDGKEIS TDDLNLYYN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.3 % (1364 of 1431) | 95.0 % (698 of 735) | 94.8 % (532 of 561) | 99.3 % (134 of 135) |
Backbone | 97.5 % (749 of 768) | 97.8 % (263 of 269) | 96.8 % (361 of 373) | 99.2 % (125 of 126) |
Sidechain | 93.6 % (728 of 778) | 93.3 % (435 of 466) | 93.7 % (284 of 303) | 100.0 % (9 of 9) |
Aromatic | 90.5 % (76 of 84) | 92.9 % (39 of 42) | 87.8 % (36 of 41) | 100.0 % (1 of 1) |
Methyl | 97.4 % (150 of 154) | 96.1 % (74 of 77) | 98.7 % (76 of 77) |
1. entity
KDDDEPGGKG AMYEVTIEQS GDFRSFIKSV VVVANGTQLK DGATGESLAS PVILSDEELA VEKVTLSTTG KAIEFAVSGG VVDGEDGVVN EPMQWVVTVY KNGKEIEKKS LVFRDGKEIS TDDLNLYYNSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001302112.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | calcium chloride | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001302112.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | calcium chloride | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001302112.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | calcium chloride | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001302112.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | calcium chloride | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001302112.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | calcium chloride | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001302112.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | calcium chloride | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001302112.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | calcium chloride | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YP_001302112.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | calcium chloride | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 25 mM | |
4 | sodium phosphate | natural abundance | 20 mM | |
5 | sodium azide | natural abundance | 5 mM | |
6 | H2O | natural abundance | 95 % | |
7 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17806_2lge.nef |
Input source #2: Coordindates | 2lge.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GDDDEPGGKGAMYEVTIEQSGDFRSFIKSVVVVANGTQLKDGATGESLASPVILSDEELAVEKVTLSTTGKAIEFAVSGGVVDGEDGVVNEPMQWVVTVY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GDDDEPGGKGAMYEVTIEQSGDFRSFIKSVVVVANGTQLKDGATGESLASPVILSDEELAVEKVTLSTTGKAIEFAVSGGVVDGEDGVVNEPMQWVVTVY -------110-------120--------- KNGKEIEKKSLVFRDGKEISTDDLNLYYN ||||||||||||||||||||||||||||| KNGKEIEKKSLVFRDGKEISTDDLNLYYN
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 129 | 0 | 0 | 100.0 |
Content subtype: combined_17806_2lge.nef
Assigned chemical shifts
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GDDDEPGGKGAMYEVTIEQSGDFRSFIKSVVVVANGTQLKDGATGESLASPVILSDEELAVEKVTLSTTGKAIEFAVSGGVVDGEDGVVNEPMQWVVTVY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .DDDEPGGKGAMYEVTIEQSGDFRSFIKSVVVVANGTQLKDGATGESLASPVILSDEELAVEKVTLSTTGKAIEFAVSGGVVDGEDGVVNEPMQWVVTVY -------110-------120--------- KNGKEIEKKSLVFRDGKEISTDDLNLYYN ||||||||||||||||||||||||||||| KNGKEIEKKSLVFRDGKEISTDDLNLYYN