Human C30S/C59S-Cox17 mutant
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 70.1 % (534 of 762) | 57.5 % (233 of 405) | 83.4 % (246 of 295) | 88.7 % (55 of 62) |
Backbone | 88.9 % (345 of 388) | 87.9 % (116 of 132) | 88.8 % (174 of 196) | 91.7 % (55 of 60) |
Sidechain | 56.4 % (246 of 436) | 42.9 % (117 of 273) | 80.1 % (129 of 161) | 0.0 % (0 of 2) |
Aromatic | 0.0 % (0 of 32) | 0.0 % (0 of 16) | 0.0 % (0 of 16) | |
Methyl | 55.8 % (29 of 52) | 11.5 % (3 of 26) | 100.0 % (26 of 26) |
1. Human C30S/C59S-Cox17 mutant
GSFTMPGLVD SNPAPPESQE KKPLKPCCAS PETKKARDAC IIEKGEEHCG HLIEAHKESM RALGFKISolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C30S/C59S-Cox17_mutant | [U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 0.5 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | C30S/C59S-Cox17_mutant | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | EDTA | natural abundance | 0.5 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 10 % | |
12 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C30S/C59S-Cox17_mutant | [U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 0.5 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | C30S/C59S-Cox17_mutant | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | EDTA | natural abundance | 0.5 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 10 % | |
12 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | C30S/C59S-Cox17_mutant | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | EDTA | natural abundance | 0.5 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 10 % | |
12 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | C30S/C59S-Cox17_mutant | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | EDTA | natural abundance | 0.5 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 10 % | |
12 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | C30S/C59S-Cox17_mutant | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | EDTA | natural abundance | 0.5 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 10 % | |
12 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | C30S/C59S-Cox17_mutant | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | EDTA | natural abundance | 0.5 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 10 % | |
12 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | C30S/C59S-Cox17_mutant | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | EDTA | natural abundance | 0.5 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 10 % | |
12 | H2O | natural abundance | 90 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | C30S/C59S-Cox17_mutant | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | EDTA | natural abundance | 0.5 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 10 % | |
12 | H2O | natural abundance | 90 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C30S/C59S-Cox17_mutant | [U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 0.5 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | C30S/C59S-Cox17_mutant | [U-99% 13C; U-99% 15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | EDTA | natural abundance | 0.5 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | D2O | natural abundance | 10 % | |
12 | H2O | natural abundance | 90 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C30S/C59S-Cox17_mutant | [U-100% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 0.5 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17821_2lgq.nef |
Input source #2: Coordindates | 2lgq.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:40:CYS:SG | A:49:CYS:SG | oxidized, CA 57.9, CB 36.4 ppm | oxidized, CA 51.7, CB 39.5 ppm | 2.042 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60------- GSFTMPGLVDSNPAPPESQEKKPLKPCCASPETKKARDACIIEKGEEHCGHLIEAHKESMRALGFKI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSFTMPGLVDSNPAPPESQEKKPLKPCCASPETKKARDACIIEKGEEHCGHLIEAHKESMRALGFKI
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 67 | 0 | 0 | 100.0 |
Content subtype: combined_17821_2lgq.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60------- GSFTMPGLVDSNPAPPESQEKKPLKPCCASPETKKARDACIIEKGEEHCGHLIEAHKESMRALGFKI ||||||||||| |||||||||| |||||||||||||||||||||||||||||||||||||||| ...TMPGLVDSNPA.PESQEKKPLK..CASPETKKARDACIIEKGEEHCGHLIEAHKESMRALGFKI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 405 | 219 | 54.1 |
13C chemical shifts | 295 | 244 | 82.7 |
15N chemical shifts | 64 | 54 | 84.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 132 | 115 | 87.1 |
13C chemical shifts | 134 | 115 | 85.8 |
15N chemical shifts | 60 | 54 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 273 | 104 | 38.1 |
13C chemical shifts | 161 | 129 | 80.1 |
15N chemical shifts | 4 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 1 | 3.6 |
13C chemical shifts | 28 | 26 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 16 | 0 | 0.0 |
13C chemical shifts | 16 | 0 | 0.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60------- GSFTMPGLVDSNPAPPESQEKKPLKPCCASPETKKARDACIIEKGEEHCGHLIEAHKESMRALGFKI | |||||| || |||||||||| |||||||||||||||||||||| |||||||||||||||| ...T.PGLVDS.PA.PESQEKKPLK...ASPETKKARDACIIEKGEEHCG.LIEAHKESMRALGFKI
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60------- GSFTMPGLVDSNPAPPESQEKKPLKPCCASPETKKARDACIIEKGEEHCGHLIEAHKESMRALGFKI ||||||||| || |||||||||| |||||||||||||||||||| |||||||||||||||||| ..FTMPGLVDS.PA..ESQEKKPLKP.CASPETKKARDACIIEKGEE.CGHLIEAHKESMRALGFK --------10--------20--------30--------40--------50--------60------