Rbx1
GGGGTNSGAG KKRFEVKKSN ASAQSAWDIV VDNCAICRNH IMDLCIECQA NQASATSEEC TVAWGVCNHA FHFHCISRWL KTRQVCPLDN REWEFQKYGH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 72.3 % (815 of 1127) | 69.1 % (403 of 583) | 77.6 % (333 of 429) | 68.7 % (79 of 115) |
Backbone | 76.1 % (455 of 598) | 74.4 % (154 of 207) | 77.4 % (226 of 292) | 75.8 % (75 of 99) |
Sidechain | 70.0 % (435 of 621) | 66.2 % (249 of 376) | 79.5 % (182 of 229) | 25.0 % (4 of 16) |
Aromatic | 77.6 % (90 of 116) | 77.6 % (45 of 58) | 77.8 % (42 of 54) | 75.0 % (3 of 4) |
Methyl | 79.8 % (67 of 84) | 78.6 % (33 of 42) | 81.0 % (34 of 42) |
1. Rbx1
GGGGTNSGAG KKRFEVKKSN ASAQSAWDIV VDNCAICRNH IMDLCIECQA NQASATSEEC TVAWGVCNHA FHFHCISRWL KTRQVCPLDN REWEFQKYGHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | entity_1 | [U-98% 15N] | 700 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 20 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
17 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | entity_1 | [U-98% 15N] | 700 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 20 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
17 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 20 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
17 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | entity_1 | [U-98% 15N] | 700 uM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 20 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
17 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 20 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
17 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 20 mM | |
14 | sodium chloride | natural abundance | 100 mM | |
15 | DTT | natural abundance | 1 mM | |
16 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
17 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz 13C-enhanced triple resonance cold probe with z-gradients
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 15N/13C-sRbx1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | Rbx1 | [U-98% 13C; U-98% 15N] | 700 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17824_2lgv.nef |
Input source #2: Coordindates | 2lgv.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:89:ASP:OD1 | 2:3:ZN:ZN | unknown | unknown | n/a |
1:72:HIS:ND1 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:37:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:75:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:74:HIS:ND1 | 2:2:ZN:ZN | unknown | unknown | n/a |
1:67:CYS:SG | 2:3:ZN:ZN | unknown | unknown | n/a |
1:60:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:48:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:86:CYS:SG | 2:3:ZN:ZN | unknown | unknown | n/a |
1:34:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:45:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:69:HIS:ND1 | 2:3:ZN:ZN | unknown | unknown | n/a |
1:89:ASP:OD2 | 2:3:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
B | 2 | ZN | ZINC ION | None |
B | 3 | ZN | ZINC ION | None |
Sequence alignments
-10-------20--------30--------40--------50--------60--------70--------80--------90-------100-------- GGGGTNSGAGKKRFEVKKSNASAQSAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GGGGTNSGAGKKRFEVKKSNASAQSAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 100 | 0 | 0 | 100.0 |
Content subtype: combined_17824_2lgv.nef
Assigned chemical shifts
-10-------20--------30--------40--------50--------60--------70--------80--------90-------100-------- GGGGTNSGAGKKRFEVKKSNASAQSAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..........................WDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 583 | 387 | 66.4 |
13C chemical shifts | 429 | 321 | 74.8 |
15N chemical shifts | 120 | 76 | 63.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 207 | 148 | 71.5 |
13C chemical shifts | 200 | 145 | 72.5 |
15N chemical shifts | 99 | 72 | 72.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 376 | 239 | 63.6 |
13C chemical shifts | 229 | 176 | 76.9 |
15N chemical shifts | 21 | 4 | 19.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 43 | 32 | 74.4 |
13C chemical shifts | 43 | 34 | 79.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 44 | 75.9 |
13C chemical shifts | 54 | 42 | 77.8 |
15N chemical shifts | 4 | 3 | 75.0 |
Covalent bonds
Distance restraints
-10-------20--------30--------40--------50--------60--------70--------80--------90-------100-------- GGGGTNSGAGKKRFEVKKSNASAQSAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH || || |||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||| ........AG..........AS....WDIVVDNCAICRNHIMDLCIECQANQAS.TSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH