1H, 15N and 13C resonance assignments for the N-terminal dimeric region of budding yeast histone chaperone Rtt106
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.9 % (734 of 835) | 86.6 % (380 of 439) | 88.0 % (287 of 326) | 95.7 % (67 of 70) |
Backbone | 94.0 % (389 of 414) | 89.2 % (124 of 139) | 96.6 % (201 of 208) | 95.5 % (64 of 67) |
Sidechain | 84.3 % (412 of 489) | 85.3 % (256 of 300) | 82.3 % (153 of 186) | 100.0 % (3 of 3) |
Aromatic | 35.4 % (17 of 48) | 70.8 % (17 of 24) | 0.0 % (0 of 24) | |
Methyl | 97.3 % (72 of 74) | 94.6 % (35 of 37) | 100.0 % (37 of 37) |
1. HISTONE CHAPERONE RTT106
GHMMSKLFLD ELPESLSRKI GTVVRVLPSS LEIFEELYKY ALNENSNDRS EHHKKPRIDD SSDLLKTDEISolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HISTONE CHAPERONE RTT106 | [U-100% 15N] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | NaCl | natural abundance | 30 mM | |
10 | Sodium Phosphate | natural abundance | 20 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95, Details 1.2 mM MIXTURE OF 15N/13C- LABELED AND UNLABELED PROTEIN
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
12 | HISTONE CHAPERONE RTT106 | natural abundance | 0.6 mM | |
13 | D2O | natural abundance | 100 % | |
14 | NaCl | natural abundance | 30 mM | |
15 | Sodium Phosphate | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | NaCl | natural abundance | 30 mM | |
5 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95, Details 1.2 mM MIXTURE OF 15N/13C- LABELED AND UNLABELED PROTEIN
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | HISTONE CHAPERONE RTT106 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
12 | HISTONE CHAPERONE RTT106 | natural abundance | 0.6 mM | |
13 | D2O | natural abundance | 100 % | |
14 | NaCl | natural abundance | 30 mM | |
15 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HISTONE CHAPERONE RTT106 | [U-100% 15N] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | NaCl | natural abundance | 30 mM | |
10 | Sodium Phosphate | natural abundance | 20 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.95
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | HISTONE CHAPERONE RTT106 | [U-100% 15N] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | NaCl | natural abundance | 30 mM | |
10 | Sodium Phosphate | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17832_2lh0.nef |
Input source #2: Coordindates | 2lh0.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------10--------20--------30--------40--------50--------60------- GHMMSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSEHHKKPRIDDSSDLLKTDEI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMMSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSEHHKKPRIDDSSDLLKTDEI --------10--------20--------30--------40--------50--------60--------70
--70-------80--------90-------100-------110-------120-------130------- GHMMSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSEHHKKPRIDDSSDLLKTDEI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMMSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSEHHKKPRIDDSSDLLKTDEI --------10--------20--------30--------40--------50--------60--------70
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 70 | 0 | 0 | 100.0 |
B | B | 70 | 0 | 0 | 100.0 |
Content subtype: combined_17832_2lh0.nef
Assigned chemical shifts
-----------10--------20--------30--------40--------50--------60------- GHMMSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSEHHKKPRIDDSSDLLKTDEI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..MMSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSEHHKKPRIDDSSDLLKTDEI
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
27 | SER | HG | 4.909 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 326 | 286 | 87.7 |
1H chemical shifts | 439 | 380 | 86.6 |
15N chemical shifts | 74 | 66 | 89.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 140 | 134 | 95.7 |
1H chemical shifts | 139 | 128 | 92.1 |
15N chemical shifts | 67 | 63 | 94.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 186 | 152 | 81.7 |
1H chemical shifts | 300 | 252 | 84.0 |
15N chemical shifts | 7 | 3 | 42.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 39 | 37 | 94.9 |
1H chemical shifts | 39 | 35 | 89.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 24 | 0 | 0.0 |
1H chemical shifts | 24 | 17 | 70.8 |
Distance restraints
-----------10--------20--------30--------40--------50--------60------- GHMMSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSEHHKKPRIDDSSDLLKTDEI |||||||||||||||||||||||||||||||||||||||||||||||| |||||| ...MSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSE..KKPRID -----------10--------20--------30--------40--------50------
--70-------80--------90-------100-------110-------120-------130------- GHMMSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSEHHKKPRIDDSSDLLKTDEI |||||||||||||||||||||||||||||||||||||||||||||||| |||||| ...MSKLFLDELPESLSRKIGTVVRVLPSSLEIFEELYKYALNENSNDRSE..KKPRID --70-------80--------90-------100-------110-------120------
Dihedral angle restraints