NOT AVAILABLE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.9 % (898 of 908) | 98.5 % (463 of 470) | 99.4 % (357 of 359) | 98.7 % (78 of 79) |
Backbone | 99.1 % (456 of 460) | 98.1 % (155 of 158) | 100.0 % (228 of 228) | 98.6 % (73 of 74) |
Sidechain | 98.8 % (514 of 520) | 98.7 % (308 of 312) | 99.0 % (201 of 203) | 100.0 % (5 of 5) |
Aromatic | 93.5 % (58 of 62) | 93.5 % (29 of 31) | 93.3 % (28 of 30) | 100.0 % (1 of 1) |
Methyl | 100.0 % (106 of 106) | 100.0 % (53 of 53) | 100.0 % (53 of 53) |
1. TDRD7
GHMLEADLVS KMLRAVLQSH KNGIVLPRLQ GEYRSLTGDW IPFKQLGYPT LEAYLRSVPA VVRIEASRSG EIVCYAVASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TDRD7 | [U-100% 15N] | 1.5 mM | |
2 | sodium acetate | natural abundance | 50 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | na | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | NH3 | nitrogen | 0.0 ppm | na | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | na | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | NH3 | nitrogen | 0.0 ppm | na | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | na | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | NH3 | nitrogen | 0.0 ppm | na | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbon | 0.0 ppm | na | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | NH3 | nitrogen | 0.0 ppm | na | direct | 1.0 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TDRD7 | [U-100% 15N] | 1.5 mM | |
2 | sodium acetate | natural abundance | 50 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TDRD7 | [U-100% 15N] | 1.5 mM | |
2 | sodium acetate | natural abundance | 50 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | TDRD7 | [U-100% 13C; U-100% 15N] | 1.5 mM | |
6 | sodium acetate | natural abundance | 50 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17835_2lh9.nef |
Input source #2: Coordindates | 2lh9.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------40--------50--------60--------70--------80--------90-------100--------- GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA --------10--------20--------30--------40--------50--------60--------70--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 78 | 0 | 0 | 100.0 |
Content subtype: combined_17835_2lh9.nef
Assigned chemical shifts
-------40--------50--------60--------70--------80--------90-------100--------- GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 470 | 467 | 99.4 |
13C chemical shifts | 359 | 357 | 99.4 |
15N chemical shifts | 85 | 84 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 158 | 157 | 99.4 |
13C chemical shifts | 156 | 156 | 100.0 |
15N chemical shifts | 74 | 73 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 312 | 310 | 99.4 |
13C chemical shifts | 203 | 201 | 99.0 |
15N chemical shifts | 11 | 11 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 55 | 100.0 |
13C chemical shifts | 55 | 55 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 29 | 93.5 |
13C chemical shifts | 30 | 28 | 93.3 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-------40--------50--------60--------70--------80--------90-------100--------- GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA
Dihedral angle restraints
-------40--------50--------60--------70--------80--------90-------100--------- GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYAVA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGEIVCYA -------40--------50--------60--------70--------80--------90-------100-------