Chemical Shift Assignments and solution structure of human apo-S100A1 E32Q mutant
GSELETAMET LINVFHAHSG KEGDKYKLSK KQLKELLQTE LSGFLDAQKD VDAVDKVMKE LDENGDGEVD FQEYVVLVAA LTVACNNFFW ENS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.5 % (1050 of 1077) | 96.8 % (537 of 555) | 98.3 % (412 of 419) | 98.1 % (101 of 103) |
Backbone | 97.3 % (543 of 558) | 95.8 % (184 of 192) | 98.2 % (268 of 273) | 97.8 % (91 of 93) |
Sidechain | 96.9 % (587 of 606) | 96.1 % (349 of 363) | 97.9 % (228 of 233) | 100.0 % (10 of 10) |
Aromatic | 98.8 % (85 of 86) | 100.0 % (43 of 43) | 97.6 % (41 of 42) | 100.0 % (1 of 1) |
Methyl | 100.0 % (106 of 106) | 100.0 % (53 of 53) | 100.0 % (53 of 53) |
1. S100A1E32Q calcium binding protein
GSELETAMET LINVFHAHSG KEGDKYKLSK KQLKELLQTE LSGFLDAQKD VDAVDKVMKE LDENGDGEVD FQEYVVLVAA LTVACNNFFW ENSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
Experiment name 2D 1H-15N T1 relaxation
Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
Experiment name 2D 1H-15N T2 relaxation
Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
Experiment name 2D 1H-15N heteronuclear NOE
Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Varian INOVA - 400 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 (±0.1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A1E32Q | [U-98% 13C; U-98% 15N] | 1 mM | |
2 | TRIS-d11 | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | natural abundance | 10 % | |
6 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17857_2m3w.nef |
Input source #2: Coordindates | 2m3w.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90--- GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
--------10--------20--------30--------40--------50--------60--------70--------80--------90--- GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 93 | 0 | 0 | 100.0 |
B | B | 93 | 0 | 0 | 100.0 |
Content subtype: combined_17857_2m3w.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90--- GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 555 | 553 | 99.6 |
13C chemical shifts | 419 | 415 | 99.0 |
15N chemical shifts | 103 | 101 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 192 | 190 | 99.0 |
13C chemical shifts | 186 | 183 | 98.4 |
15N chemical shifts | 93 | 91 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 363 | 363 | 100.0 |
13C chemical shifts | 233 | 232 | 99.6 |
15N chemical shifts | 10 | 10 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 55 | 100.0 |
13C chemical shifts | 55 | 55 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 43 | 43 | 100.0 |
13C chemical shifts | 42 | 41 | 97.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90--- GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..ELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
--------10--------20--------30--------40--------50--------60--------70--------80--------90--- GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..ELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90--- GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS ||||||||||||||||||| |||||||||||| ||||||||||||| |||||||||||||||| .SELETAMETLINVFHAHSG.........KKQLKELLQTEL.........VDAVDKVMKELDE.......FQEYVVLVAALTVACN --------10--------20--------30--------40--------50--------60--------70--------80------
--------10--------20--------30--------40--------50--------60--------70--------80--------90--- GSELETAMETLINVFHAHSGKEGDKYKLSKKQLKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS ||||||||||||||||||| |||||||||||| ||||||||||||| |||||||||||||||| .SELETAMETLINVFHAHSG.........KKQLKELLQTEL.........VDAVDKVMKELDE.......FQEYVVLVAALTVACN --------10--------20--------30--------40--------50--------60--------70--------80------