Solution structure of Staphylococcus aureus IsdH linker domain
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.2 % (925 of 962) | 95.7 % (486 of 508) | 96.5 % (357 of 370) | 97.6 % (82 of 84) |
Backbone | 97.2 % (449 of 462) | 97.4 % (149 of 153) | 97.0 % (227 of 234) | 97.3 % (73 of 75) |
Sidechain | 95.5 % (552 of 578) | 94.9 % (337 of 355) | 96.3 % (206 of 214) | 100.0 % (9 of 9) |
Aromatic | 82.3 % (51 of 62) | 83.9 % (26 of 31) | 80.6 % (25 of 31) | |
Methyl | 100.0 % (82 of 82) | 100.0 % (41 of 41) | 100.0 % (41 of 41) |
1. entity
SDDYVDEETY NLQKLLAPYH KAKTLERQVY ELEKLQEKLP EKYKAEYKKK LDQTRVELAD QVKSAVTEFE NVTPTNDQSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IsdH linker | [U-100% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | AEBSF protease inhibitor | natural abundance | 100 uM | |
5 | sodium azide | natural abundance | 0.01 % | |
6 | D2O | natural abundance | 7 % | |
7 | H2O | natural abundance | 93 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
9 | potassium phosphate | natural abundance | 20 mM | |
10 | potassium chloride | natural abundance | 50 mM | |
11 | AEBSF protease inhibitor | natural abundance | 100 uM | |
12 | sodium azide | natural abundance | 0.01 % | |
13 | D2O | natural abundance | 7 % | |
14 | H2O | natural abundance | 93 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
16 | potassium phosphate | natural abundance | 20 mM | |
17 | potassium chloride | natural abundance | 50 mM | |
18 | AEBSF protease inhibitor | natural abundance | 100 uM | |
19 | sodium azide | natural abundance | 0.01 % | |
20 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IsdH linker | [U-100% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | AEBSF protease inhibitor | natural abundance | 100 uM | |
5 | sodium azide | natural abundance | 0.01 % | |
6 | D2O | natural abundance | 7 % | |
7 | H2O | natural abundance | 93 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
9 | potassium phosphate | natural abundance | 20 mM | |
10 | potassium chloride | natural abundance | 50 mM | |
11 | AEBSF protease inhibitor | natural abundance | 100 uM | |
12 | sodium azide | natural abundance | 0.01 % | |
13 | D2O | natural abundance | 7 % | |
14 | H2O | natural abundance | 93 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
9 | potassium phosphate | natural abundance | 20 mM | |
10 | potassium chloride | natural abundance | 50 mM | |
11 | AEBSF protease inhibitor | natural abundance | 100 uM | |
12 | sodium azide | natural abundance | 0.01 % | |
13 | D2O | natural abundance | 7 % | |
14 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
9 | potassium phosphate | natural abundance | 20 mM | |
10 | potassium chloride | natural abundance | 50 mM | |
11 | AEBSF protease inhibitor | natural abundance | 100 uM | |
12 | sodium azide | natural abundance | 0.01 % | |
13 | D2O | natural abundance | 7 % | |
14 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
9 | potassium phosphate | natural abundance | 20 mM | |
10 | potassium chloride | natural abundance | 50 mM | |
11 | AEBSF protease inhibitor | natural abundance | 100 uM | |
12 | sodium azide | natural abundance | 0.01 % | |
13 | D2O | natural abundance | 7 % | |
14 | H2O | natural abundance | 93 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
9 | potassium phosphate | natural abundance | 20 mM | |
10 | potassium chloride | natural abundance | 50 mM | |
11 | AEBSF protease inhibitor | natural abundance | 100 uM | |
12 | sodium azide | natural abundance | 0.01 % | |
13 | D2O | natural abundance | 7 % | |
14 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
9 | potassium phosphate | natural abundance | 20 mM | |
10 | potassium chloride | natural abundance | 50 mM | |
11 | AEBSF protease inhibitor | natural abundance | 100 uM | |
12 | sodium azide | natural abundance | 0.01 % | |
13 | D2O | natural abundance | 7 % | |
14 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IsdH linker | [U-100% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | AEBSF protease inhibitor | natural abundance | 100 uM | |
5 | sodium azide | natural abundance | 0.01 % | |
6 | D2O | natural abundance | 7 % | |
7 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IsdH linker | [U-100% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | AEBSF protease inhibitor | natural abundance | 100 uM | |
5 | sodium azide | natural abundance | 0.01 % | |
6 | D2O | natural abundance | 7 % | |
7 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
9 | potassium phosphate | natural abundance | 20 mM | |
10 | potassium chloride | natural abundance | 50 mM | |
11 | AEBSF protease inhibitor | natural abundance | 100 uM | |
12 | sodium azide | natural abundance | 0.01 % | |
13 | D2O | natural abundance | 7 % | |
14 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IsdH linker | [U-100% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | AEBSF protease inhibitor | natural abundance | 100 uM | |
5 | sodium azide | natural abundance | 0.01 % | |
6 | D2O | natural abundance | 7 % | |
7 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
9 | potassium phosphate | natural abundance | 20 mM | |
10 | potassium chloride | natural abundance | 50 mM | |
11 | AEBSF protease inhibitor | natural abundance | 100 uM | |
12 | sodium azide | natural abundance | 0.01 % | |
13 | D2O | natural abundance | 7 % | |
14 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
16 | potassium phosphate | natural abundance | 20 mM | |
17 | potassium chloride | natural abundance | 50 mM | |
18 | AEBSF protease inhibitor | natural abundance | 100 uM | |
19 | sodium azide | natural abundance | 0.01 % | |
20 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IsdH linker | [U-100% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | potassium chloride | natural abundance | 50 mM | |
4 | AEBSF protease inhibitor | natural abundance | 100 uM | |
5 | sodium azide | natural abundance | 0.01 % | |
6 | D2O | natural abundance | 7 % | |
7 | H2O | natural abundance | 93 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
9 | potassium phosphate | natural abundance | 20 mM | |
10 | potassium chloride | natural abundance | 50 mM | |
11 | AEBSF protease inhibitor | natural abundance | 100 uM | |
12 | sodium azide | natural abundance | 0.01 % | |
13 | D2O | natural abundance | 7 % | |
14 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
16 | potassium phosphate | natural abundance | 20 mM | |
17 | potassium chloride | natural abundance | 50 mM | |
18 | AEBSF protease inhibitor | natural abundance | 100 uM | |
19 | sodium azide | natural abundance | 0.01 % | |
20 | D2O | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
9 | potassium phosphate | natural abundance | 20 mM | |
10 | potassium chloride | natural abundance | 50 mM | |
11 | AEBSF protease inhibitor | natural abundance | 100 uM | |
12 | sodium azide | natural abundance | 0.01 % | |
13 | D2O | natural abundance | 7 % | |
14 | H2O | natural abundance | 93 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
16 | potassium phosphate | natural abundance | 20 mM | |
17 | potassium chloride | natural abundance | 50 mM | |
18 | AEBSF protease inhibitor | natural abundance | 100 uM | |
19 | sodium azide | natural abundance | 0.01 % | |
20 | D2O | natural abundance | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
16 | potassium phosphate | natural abundance | 20 mM | |
17 | potassium chloride | natural abundance | 50 mM | |
18 | AEBSF protease inhibitor | natural abundance | 100 uM | |
19 | sodium azide | natural abundance | 0.01 % | |
20 | D2O | natural abundance | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
16 | potassium phosphate | natural abundance | 20 mM | |
17 | potassium chloride | natural abundance | 50 mM | |
18 | AEBSF protease inhibitor | natural abundance | 100 uM | |
19 | sodium azide | natural abundance | 0.01 % | |
20 | D2O | natural abundance | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | IsdH linker | [U-100% 13C; U-100% 15N] | 1.3 mM | |
16 | potassium phosphate | natural abundance | 20 mM | |
17 | potassium chloride | natural abundance | 50 mM | |
18 | AEBSF protease inhibitor | natural abundance | 100 uM | |
19 | sodium azide | natural abundance | 0.01 % | |
20 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17862_2lhr.nef |
Input source #2: Coordindates | 2lhr.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--470-------480-------490-------500-------510-------520-------530-------540--- SDDYVDEETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDDYVDEETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQ --------10--------20--------30--------40--------50--------60--------70--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 78 | 0 | 0 | 100.0 |
Content subtype: combined_17862_2lhr.nef
Assigned chemical shifts
--470-------480-------490-------500-------510-------520-------530-------540--- SDDYVDEETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..DYVDEETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQ
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 508 | 486 | 95.7 |
13C chemical shifts | 370 | 357 | 96.5 |
15N chemical shifts | 86 | 82 | 95.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 153 | 149 | 97.4 |
13C chemical shifts | 156 | 151 | 96.8 |
15N chemical shifts | 75 | 73 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 355 | 337 | 94.9 |
13C chemical shifts | 214 | 206 | 96.3 |
15N chemical shifts | 11 | 9 | 81.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 41 | 100.0 |
13C chemical shifts | 41 | 41 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 26 | 83.9 |
13C chemical shifts | 31 | 25 | 80.6 |
Distance restraints
--470-------480-------490-------500-------510-------520-------530-------540--- SDDYVDEETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..DYVDEETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQ
Dihedral angle restraints
--470-------480-------490-------500-------510-------520-------530-------540--- SDDYVDEETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......ETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVK --470-------480-------490-------500-------510-------520--------