Solution structure of Venturia inaequalis cellophane-induced 1 protein (ViCin1) domains 1 and 2
ADVFDPPTQY GYDGKPLDAS FCRTAGSREK DCRKDVQACD KKYDDQGRET ACAKGIREKY KPAVVYGYDG KPLDLGFCTL AGIREVDCRK DAQTCDKKYE SDKCLNAIKE KYKPVVDPNP PA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.7 % (1318 of 1392) | 95.5 % (703 of 736) | 93.3 % (501 of 537) | 95.8 % (114 of 119) |
Backbone | 96.6 % (690 of 714) | 97.5 % (238 of 244) | 96.4 % (344 of 357) | 95.6 % (108 of 113) |
Sidechain | 93.7 % (741 of 791) | 94.5 % (465 of 492) | 92.2 % (270 of 293) | 100.0 % (6 of 6) |
Aromatic | 68.1 % (64 of 94) | 76.6 % (36 of 47) | 59.6 % (28 of 47) | |
Methyl | 96.7 % (89 of 92) | 97.8 % (45 of 46) | 95.7 % (44 of 46) |
1. ViCin1-D1D2
ADVFDPPTQY GYDGKPLDAS FCRTAGSREK DCRKDVQACD KKYDDQGRET ACAKGIREKY KPAVVYGYDG KPLDLGFCTL AGIREVDCRK DAQTCDKKYE SDKCLNAIKE KYKPVVDPNP PASolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
6 | potassium phosphate | natural abundance | 25 mM | |
7 | polyacrylamide gel | natural abundance | 5-6 % | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298.15 K, pH 6.2
Experiment name 2D 1H-15N R1 relaxation
Pressure 1 atm, Temperature 298.15 K, pH 6.2
Experiment name 2D 1H-15N R2 relaxation
Pressure 1 atm, Temperature 298.15 K, pH 6.2
Experiment name 2D 1H-15N heteronuclear NOE
Pressure 1 atm, Temperature 298.15 K, pH 6.2
Pressure 1 atm, Temperature 298.15 K, pH 6.2
Experiment name 2D 1H-15N heteronuclear NOE, 2D 1H-15N R1 relaxation, 2D 1H-15N R2 relaxation
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 1.0 mM | |
6 | potassium phosphate | natural abundance | 25 mM | |
7 | polyacrylamide gel | natural abundance | 5-6 % | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298.15 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ViCin1-D1D2 | [U-99% 13C; U-99% 15N] | 0.6-0.8 mM | |
2 | potassium phosphate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 95 % | |
4 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_17865_2lht.nef |
Input source #2: Coordindates | 2lht.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---30--------40--------50--------60--------70--------80--------90-------100-------110-------120----- ADVFDPPTQYGYDGKPLDASFCRTAGSREKDCRKDVQACDKKYDDQGRETACAKGIREKYKPAVVYGYDGKPLDLGFCTLAGIREVDCRKDAQTCDKKYE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ADVFDPPTQYGYDGKPLDASFCRTAGSREKDCRKDVQACDKKYDDQGRETACAKGIREKYKPAVVYGYDGKPLDLGFCTLAGIREVDCRKDAQTCDKKYE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --130-------140------- SDKCLNAIKEKYKPVVDPNPPA |||||||||||||||||||||| SDKCLNAIKEKYKPVVDPNPPA -------110-------120--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 122 | 0 | 0 | 100.0 |
Content subtype: combined_17865_2lht.nef
Assigned chemical shifts
---30--------40--------50--------60--------70--------80--------90-------100-------110-------120----- ADVFDPPTQYGYDGKPLDASFCRTAGSREKDCRKDVQACDKKYDDQGRETACAKGIREKYKPAVVYGYDGKPLDLGFCTLAGIREVDCRKDAQTCDKKYE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ADVFDPPTQYGYDGKPLDASFCRTAGSREKDCRKDVQACDKKYDDQGRETACAKGIREKYKPAVVYGYDGKPLDLGFCTLAGIREVDCRKDAQTCDKKYE --130-------140------- SDKCLNAIKEKYKPVVDPNPPA |||||||||||||||||||||| SDKCLNAIKEKYKPVVDPNPPA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 736 | 703 | 95.5 |
13C chemical shifts | 537 | 499 | 92.9 |
15N chemical shifts | 126 | 114 | 90.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 244 | 238 | 97.5 |
13C chemical shifts | 244 | 230 | 94.3 |
15N chemical shifts | 113 | 108 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 492 | 465 | 94.5 |
13C chemical shifts | 293 | 269 | 91.8 |
15N chemical shifts | 13 | 6 | 46.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 45 | 97.8 |
13C chemical shifts | 46 | 44 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 36 | 76.6 |
13C chemical shifts | 47 | 28 | 59.6 |
Covalent bonds
Distance restraints
---30--------40--------50--------60--------70--------80--------90-------100-------110-------120----- ADVFDPPTQYGYDGKPLDASFCRTAGSREKDCRKDVQACDKKYDDQGRETACAKGIREKYKPAVVYGYDGKPLDLGFCTLAGIREVDCRKDAQTCDKKYE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||| .DVFDPPTQYGYDGKPLDASFCRTAGSREKDCRKDVQACDKKYDDQGRETACAKGIREKYKPAVVYGYDGK.LDLGFCTLAGIREVDCRKDAQTCDKKYE --130-------140------- SDKCLNAIKEKYKPVVDPNPPA |||||||||||||||||||||| SDKCLNAIKEKYKPVVDPNPPA
Dihedral angle restraints
---30--------40--------50--------60--------70--------80--------90-------100-------110-------120----- ADVFDPPTQYGYDGKPLDASFCRTAGSREKDCRKDVQACDKKYDDQGRETACAKGIREKYKPAVVYGYDGKPLDLGFCTLAGIREVDCRKDAQTCDKKYE |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..VFDP.......GKPLDASFCRTAGSREKDCRKDVQACDKKYDDQGRETACAKGIREKYKPAVVYGYDGKPLDLGFCTLAGIREVDCRKDAQTCDKKYE ---30--------40--------50--------60--------70--------80--------90-------100-------110-------120----- --130-------140------- SDKCLNAIKEKYKPVVDPNPPA |||||||||||||||||||| SDKCLNAIKEKYKPVVDPNP --130-------140-----
RDC restraints