NMR structure of Atg8-Atg7C30 complex
HMKSTFKSEY PFEKRKAESE RIADRFPNRI PVICEKAEKS DIPEIDKRKY LVPADLTVGQ FVYVIRKRIM LPPEKAIFIF VNDTLPPTAA LMSAIYQEHK DKDGFLYVTY SGENTFG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.3 % (1752 of 1820) | 97.7 % (932 of 954) | 93.6 % (671 of 717) | 100.0 % (149 of 149) |
Backbone | 98.1 % (869 of 886) | 98.3 % (294 of 299) | 97.3 % (434 of 446) | 100.0 % (141 of 141) |
Sidechain | 95.3 % (1027 of 1078) | 97.4 % (638 of 655) | 91.8 % (381 of 415) | 100.0 % (8 of 8) |
Aromatic | 81.5 % (132 of 162) | 100.0 % (81 of 81) | 62.5 % (50 of 80) | 100.0 % (1 of 1) |
Methyl | 100.0 % (154 of 154) | 100.0 % (77 of 77) | 100.0 % (77 of 77) |
1. Atg8K26P
HMKSTFKSEY PFEKRKAESE RIADRFPNRI PVICEKAEKS DIPEIDKRKY LVPADLTVGQ FVYVIRKRIM LPPEKAIFIF VNDTLPPTAA LMSAIYQEHK DKDGFLYVTY SGENTFG2. ATG7C30
GPHMISGLSV IKQEVERLGN DVFEWEDDES DEIASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Atg8K26P | [U-99% 13C; U-99% 15N] | 0.8 mM | |
2 | ATG7C30 | natural abundance | 2.0 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | DTT | natural abundance | 5 mM | |
6 | DSS | natural abundance | 5 ug | |
7 | sodium azide | natural abundance | 0.02 % | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | ATG7C30 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
11 | Atg8K26P | natural abundance | 1.25 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 5 mM | |
15 | DSS | natural abundance | 5 ug | |
16 | sodium azide | natural abundance | 0.02 % | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17879_2li5.nef |
Input source #2: Coordindates | 2li5.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 HMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------110------ DKDGFLYVTYSGENTFG ||||||||||||||||| DKDGFLYVTYSGENTFG -------110-------
---600-----610-------620-------630 GPHMISGLSVIKQEVERLGNDVFEWEDDESDEIA |||||||||||||||||||||||||||||||||| GPHMISGLSVIKQEVERLGNDVFEWEDDESDEIA --------10--------20--------30----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 117 | 0 | 0 | 100.0 |
B | B | 34 | 0 | 0 | 100.0 |
Content subtype: combined_17879_2li5.nef
Assigned chemical shifts
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 HMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHK 0-------110------ DKDGFLYVTYSGENTFG ||||||||||||||||| DKDGFLYVTYSGENTFG
---600-----610-------620-------630 GPHMISGLSVIKQEVERLGNDVFEWEDDESDEIA |||||||||||||||||||||||||||||||||| GPHMISGLSVIKQEVERLGNDVFEWEDDESDEIA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
18 | SER | HG | 6.435 |
20 | ARG | CZ | 160.022 |
24 | ARG | CZ | 159.504 |
27 | ASN | CG | 178.019 |
28 | ARG | CZ | 159.507 |
33 | CYS | HG | 1.379 |
56 | THR | HG1 | 5.625 |
59 | GLN | CD | 180.13 |
65 | ARG | HH11 | 6.561 |
65 | ARG | CZ | 159.277 |
67 | ARG | HH11 | 6.958 |
67 | ARG | CZ | 159.684 |
81 | ASN | CG | 177.96 |
96 | GLN | CD | 180.126 |
109 | TYR | HH | 9.706 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 756 | 745 | 98.5 |
13C chemical shifts | 569 | 526 | 92.4 |
15N chemical shifts | 120 | 118 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 229 | 228 | 99.6 |
13C chemical shifts | 234 | 223 | 95.3 |
15N chemical shifts | 108 | 108 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 527 | 517 | 98.1 |
13C chemical shifts | 335 | 303 | 90.4 |
15N chemical shifts | 12 | 10 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 63 | 100.0 |
13C chemical shifts | 63 | 63 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 68 | 100.0 |
13C chemical shifts | 68 | 40 | 58.8 |
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
609 | GLN | CD | 180.299 |
613 | ARG | CZ | 159.641 |
616 | ASN | CG | 176.928 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 198 | 197 | 99.5 |
13C chemical shifts | 148 | 143 | 96.6 |
15N chemical shifts | 37 | 36 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 69 | 98.6 |
13C chemical shifts | 68 | 65 | 95.6 |
15N chemical shifts | 33 | 32 | 97.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 128 | 128 | 100.0 |
13C chemical shifts | 80 | 78 | 97.5 |
15N chemical shifts | 4 | 4 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 18 | 18 | 100.0 |
13C chemical shifts | 18 | 18 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 13 | 13 | 100.0 |
13C chemical shifts | 12 | 10 | 83.3 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 HMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHK 0-------110------ DKDGFLYVTYSGENTFG ||||||||||||||||| DKDGFLYVTYSGENTFG
---600-----610-------620-------630 GPHMISGLSVIKQEVERLGNDVFEWEDDESDEIA |||||||||||||||||||||||||||||||||| GPHMISGLSVIKQEVERLGNDVFEWEDDESDEIA
Dihedral angle restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 HMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..KSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHK 0-------110------ DKDGFLYVTYSGENTFG ||||||||||||||||| DKDGFLYVTYSGENTFG