In response to the declaration of global pandemic of Coronavirus infectious disease 2019 (COVID-19) caused by Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), we provide comprehensive content on Coronavirus molecular structures and its interactions:
C-terminal domain of SARS-CoV main protease
DRQTAQAAGT DTTITLNVLA WLYAAVINGD RWFLNRFTTT LNDFNLVAMK YNYEPLTQDH VDILGPLSAQ TGIAVLDMCA ALKELLQNGM NGRTILGSTI LEDEFTPFDV VRQCSGVTFQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.6 % (1143 of 1367) | 90.6 % (630 of 695) | 71.4 % (384 of 538) | 96.3 % (129 of 134) |
Backbone | 84.5 % (603 of 714) | 97.1 % (238 of 245) | 71.6 % (252 of 352) | 96.6 % (113 of 117) |
Sidechain | 85.2 % (652 of 765) | 87.1 % (392 of 450) | 81.9 % (244 of 298) | 94.1 % (16 of 17) |
Aromatic | 34.8 % (39 of 112) | 58.9 % (33 of 56) | 7.4 % (4 of 54) | 100.0 % (2 of 2) |
Methyl | 95.8 % (159 of 166) | 95.2 % (79 of 83) | 96.4 % (80 of 83) |
1. Mpro-C
DRQTAQAAGT DTTITLNVLA WLYAAVINGD RWFLNRFTTT LNDFNLVAMK YNYEPLTQDH VDILGPLSAQ TGIAVLDMCA ALKELLQNGM NGRTILGSTI LEDEFTPFDV VRQCSGVTFQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Mpro-C | [U-100% 15N] | 1 mM | |
2 | Mpro-C | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | DTT | natural abundance | 1 mM | |
6 | PBS | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Mpro-C | [U-100% 15N] | 1 mM | |
2 | Mpro-C | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | DTT | natural abundance | 1 mM | |
6 | PBS | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Mpro-C | [U-100% 15N] | 1 mM | |
2 | Mpro-C | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | DTT | natural abundance | 1 mM | |
6 | PBS | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Mpro-C | [U-100% 15N] | 1 mM | |
2 | Mpro-C | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | DTT | natural abundance | 1 mM | |
6 | PBS | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Mpro-C | [U-100% 15N] | 1 mM | |
2 | Mpro-C | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | DTT | natural abundance | 1 mM | |
6 | PBS | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Mpro-C | [U-100% 15N] | 1 mM | |
2 | Mpro-C | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | DTT | natural abundance | 1 mM | |
6 | PBS | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Mpro-C | [U-100% 15N] | 1 mM | |
2 | Mpro-C | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | DTT | natural abundance | 1 mM | |
6 | PBS | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Mpro-C | [U-100% 15N] | 1 mM | |
2 | Mpro-C | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | DTT | natural abundance | 1 mM | |
6 | PBS | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Mpro-C | [U-100% 15N] | 1 mM | |
2 | Mpro-C | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | DTT | natural abundance | 1 mM | |
6 | PBS | natural abundance | 50 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Mpro-C | [U-100% 15N] | 1 mM | |
2 | Mpro-C | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | DTT | natural abundance | 1 mM | |
6 | PBS | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17911_2liz.nef |
Input source #2: Coordindates | 2liz.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---190-----200-------210-------220-------230-------240-------250-------260-------270-------280------ DRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| DRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -290-------300------ LEDEFTPFDVVRQCSGVTFQ |||||||||||||||||||| LEDEFTPFDVVRQCSGVTFQ -------110-------120
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 120 | 0 | 0 | 100.0 |
Content subtype: combined_17911_2liz.nef
Assigned chemical shifts
---190-----200-------210-------220-------230-------240-------250-------260-------270-------280------ DRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| DRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTI -290-------300------ LEDEFTPFDVVRQCSGVTFQ |||||||||||||||||||| LEDEFTPFDVVRQCSGVTFQ
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
209 | TYR | HH | 7.358 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 695 | 628 | 90.4 |
13C chemical shifts | 538 | 360 | 66.9 |
15N chemical shifts | 139 | 129 | 92.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 245 | 241 | 98.4 |
13C chemical shifts | 240 | 120 | 50.0 |
15N chemical shifts | 117 | 113 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 450 | 387 | 86.0 |
13C chemical shifts | 298 | 240 | 80.5 |
15N chemical shifts | 22 | 16 | 72.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 86 | 83 | 96.5 |
13C chemical shifts | 86 | 83 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 31 | 55.4 |
13C chemical shifts | 54 | 0 | 0.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
---190-----200-------210-------220-------230-------240-------250-------260-------270-------280------ DRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| DRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTI -290-------300------ LEDEFTPFDVVRQCSGVTFQ |||||||||||||||||||| LEDEFTPFDVVRQCSGVTFQ
Dihedral angle restraints