Solution structure of putative oxidoreductase from Ehrlichia chaffeensis. (Seattle Structural Genomics Center for Infectious Disease (SSGCID))
MQEQVSNVRA RIYKPAKSTM QSGHSKLKAW KLEFEPSCTQ YTEPLMNWTG SHDTKQQVCL SFTTRELAIA YAVAHKIDYT VLQDNPRTIV PKSYADNFTK PRDM
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 72.4 % (900 of 1243) | 63.4 % (412 of 650) | 80.3 % (387 of 482) | 91.0 % (101 of 111) |
Backbone | 91.8 % (562 of 612) | 85.8 % (175 of 204) | 95.5 % (296 of 310) | 92.9 % (91 of 98) |
Sidechain | 59.5 % (436 of 733) | 53.1 % (237 of 446) | 69.0 % (189 of 274) | 76.9 % (10 of 13) |
Aromatic | 37.7 % (40 of 106) | 47.2 % (25 of 53) | 25.5 % (13 of 51) | 100.0 % (2 of 2) |
Methyl | 79.0 % (79 of 100) | 76.0 % (38 of 50) | 82.0 % (41 of 50) |
1. putative oxidoreductase from Ehrlichia chaffeensis
MQEQVSNVRA RIYKPAKSTM QSGHSKLKAW KLEFEPSCTQ YTEPLMNWTG SHDTKQQVCL SFTTRELAIA YAVAHKIDYT VLQDNPRTIV PKSYADNFTK PRDMSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | oxidoreductase | [U-95% 15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | oxidoreductase | [U-95% 13C; U-95% 15N] | 0.5 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | oxidoreductase | [U-95% 15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | oxidoreductase | [U-95% 13C; U-95% 15N] | 0.5 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | oxidoreductase | [U-95% 15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | oxidoreductase | [U-95% 13C; U-95% 15N] | 0.5 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | oxidoreductase | [U-95% 13C; U-95% 15N] | 0.5 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | oxidoreductase | [U-95% 13C; U-95% 15N] | 0.5 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | oxidoreductase | [U-95% 13C; U-95% 15N] | 0.5 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | oxidoreductase | [U-95% 13C; U-95% 15N] | 0.5 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | oxidoreductase | [U-95% 13C; U-95% 15N] | 0.5 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | oxidoreductase | [U-95% 13C; U-95% 15N] | 0.5 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | oxidoreductase | [U-95% 13C; U-95% 15N] | 0.5 mM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | DTT | natural abundance | 1 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17962_2lju.nef |
Input source #2: Coordindates | 2lju.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ GPGSMQEQVSNVRARIYKPAKSTMQSGHSKLKAWKLEFEPSCTQYTEPLMNWTGSHDTKQQVCLSFTTRELAIAYAVAHKIDYTVLQDNPRTIVPKSYAD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPGSMQEQVSNVRARIYKPAKSTMQSGHSKLKAWKLEFEPSCTQYTEPLMNWTGSHDTKQQVCLSFTTRELAIAYAVAHKIDYTVLQDNPRTIVPKSYAD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -100---- NFTKPRDM |||||||| NFTKPRDM --------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_17962_2lju.nef
Assigned chemical shifts
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ GPGSMQEQVSNVRARIYKPAKSTMQSGHSKLKAWKLEFEPSCTQYTEPLMNWTGSHDTKQQVCLSFTTRELAIAYAVAHKIDYTVLQDNPRTIVPKSYAD ||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....MQEQVSNVRARIYKPAK.TMQSGHSKLKAWKLEFEPSCTQYTEPLMNWTGSHDTKQQVCLSFTTRELAIAYAVAHKIDYTVLQDNPRTIVPKSYAD -100---- NFTKPRDM |||||||| NFTKPRDM
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 667 | 395 | 59.2 |
13C chemical shifts | 494 | 381 | 77.1 |
15N chemical shifts | 119 | 99 | 83.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 213 | 177 | 83.1 |
13C chemical shifts | 216 | 196 | 90.7 |
15N chemical shifts | 101 | 91 | 90.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 454 | 218 | 48.0 |
13C chemical shifts | 278 | 185 | 66.5 |
15N chemical shifts | 18 | 8 | 44.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 38 | 70.4 |
13C chemical shifts | 54 | 41 | 75.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 25 | 47.2 |
13C chemical shifts | 51 | 13 | 25.5 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
------------10--------20--------30--------40--------50--------60--------70--------80--------90------ GPGSMQEQVSNVRARIYKPAKSTMQSGHSKLKAWKLEFEPSCTQYTEPLMNWTGSHDTKQQVCLSFTTRELAIAYAVAHKIDYTVLQDNPRTIVPKSYAD ||||||||||||||| ||||||||||||| |||| ||| |||||||||||||||||||||||||||||||||||| ||| ......EQVSNVRARIYKPAK.......SKLKAWKLEFEPS..QYTE.LMN.......KQQVCLSFTTRELAIAYAVAHKIDYTVLQDNPRTIV...YAD ------------10--------20--------30--------40--------50--------60--------70--------80--------90------ -100---- NFTKPRDM || || ..TK.RD -100---