Onconase zymogen FLG variant
RPCKYKLKKS TNKFCVTCEN QAPVHFVGVG SCGSGGSGIF LETSLSAGSD WLTFQKKHIT NTRDVDCXNI MSTNLFHCKD KNTFIYSRPE PVKAICKGII ASKNVLTTSE FYLSDCNVTS
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS15:SG | 1:CYS32:SG |
2 | disulfide | sing | 1:CYS18:SG | 1:CYS96:SG |
3 | disulfide | sing | 1:CYS3:SG | 1:CYS78:SG |
4 | disulfide | sing | 1:CYS67:SG | 1:CYS116:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.5 % (1306 of 1367) | 97.3 % (688 of 707) | 92.3 % (493 of 534) | 99.2 % (125 of 126) |
Backbone | 98.6 % (696 of 706) | 99.2 % (240 of 242) | 98.0 % (342 of 349) | 99.1 % (114 of 115) |
Sidechain | 93.3 % (720 of 772) | 96.3 % (448 of 465) | 88.2 % (261 of 296) | 100.0 % (11 of 11) |
Aromatic | 72.0 % (85 of 118) | 91.5 % (54 of 59) | 51.7 % (30 of 58) | 100.0 % (1 of 1) |
Methyl | 98.3 % (116 of 118) | 100.0 % (59 of 59) | 96.6 % (57 of 59) |
1. onconase FLG variant
RPCKYKLKKS TNKFCVTCEN QAPVHFVGVG SCGSGGSGIF LETSLSAGSD WLTFQKKHIT NTRDVDCXNI MSTNLFHCKD KNTFIYSRPE PVKAICKGII ASKNVLTTSE FYLSDCNVTSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | buffer 10x | natural abundance | 25 uL | |
7 | D2O | [U-100% 2H] | 200 uL | |
8 | DSS | natural abundance | 2 uL | |
9 | NaN3 | natural abundance | 2 uL | |
10 | ONC_FLG | [U-100% 15N] | 1.8 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | buffer 10x | natural abundance | 25 uL | |
7 | D2O | [U-100% 2H] | 200 uL | |
8 | DSS | natural abundance | 2 uL | |
9 | NaN3 | natural abundance | 2 uL | |
10 | ONC_FLG | [U-100% 15N] | 1.8 mM |
Bruker Avance - 800 MHz Bruker AV-800 US2, equipped with a TCI cryoprobe (1H,13C,15N) with Z-gradients and two 5mm probe with gradients in XYZ: TXI (1H,13C,15N), QXI(1H,13C,15N,31P).
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | buffer 10x | natural abundance | 25 uL | |
2 | H2O MQ | natural abundance | 200 uL | |
3 | DSS | natural abundance | 2 uL | |
4 | NaN3 | natural abundance | 2 uL | |
5 | ONC_FLG | [U-100% 15N; U-13C] | 2.8 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_17973_2lt5.nef |
Input source #2: Coordindates | 2lt5.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:3:CYS:SG | A:78:CYS:SG | unknown | unknown | 2.032 |
A:15:CYS:SG | A:32:CYS:SG | unknown | unknown | 2.036 |
A:18:CYS:SG | A:96:CYS:SG | unknown | unknown | 2.031 |
A:67:CYS:SG | A:116:CYS:SG | unknown | unknown | 2.029 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RPCKYKLKKSTNKFCVTCENQAPVHFVGVGSCGSGGSGIFLETSLSAGSDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGII |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RPCKYKLKKSTNKFCVTCENQAPVHFVGVGSCGSGGSGIFLETSLSAGSDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGII -------110-------120 ASKNVLTTSEFYLSDCNVTS |||||||||||||||||||| ASKNVLTTSEFYLSDCNVTS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 120 | 0 | 0 | 100.0 |
Content subtype: combined_17973_2lt5.nef
Assigned chemical shifts
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 RPCKYKLKKSTNKFCVTCENQAPVHFVGVGSCGSGGSGIFLETSLSAGSDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGII ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PCKYKLKKSTNKFCVTCENQAPVHFVGVGSCGSGGSGIFLETSLSAGSDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGII -------110-------120 ASKNVLTTSEFYLSDCNVTS |||||||||||||||||||| ASKNVLTTSEFYLSDCNVTS