Solution structure of MSMEG_1053, the second DUF3349 annotated protein in the genome of Mycobacterium smegmatis. Seattle Structural Genomics Center for Infectious Disease (SSGCID) target MysmA.17112.b
GPGSMVNAFL AKIAAWLNAG YPEGVPGPDR VPLLALLTRR LTNDEIKAIA EDLEKRAHFD HIDIGVLITQ MTDEMPREED IERVRRHLAL QGWPLDDPRD GEEPDGESGG PR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.8 % (1150 of 1267) | 90.4 % (600 of 664) | 90.5 % (447 of 494) | 94.5 % (103 of 109) |
Backbone | 90.2 % (588 of 652) | 89.3 % (201 of 225) | 89.5 % (291 of 325) | 94.1 % (96 of 102) |
Sidechain | 92.5 % (662 of 716) | 90.9 % (399 of 439) | 94.8 % (256 of 270) | 100.0 % (7 of 7) |
Aromatic | 78.1 % (50 of 64) | 78.1 % (25 of 32) | 76.7 % (23 of 30) | 100.0 % (2 of 2) |
Methyl | 96.0 % (119 of 124) | 95.2 % (59 of 62) | 96.8 % (60 of 62) |
1. entity
GPGSMVNAFL AKIAAWLNAG YPEGVPGPDR VPLLALLTRR LTNDEIKAIA EDLEKRAHFD HIDIGVLITQ MTDEMPREED IERVRRHLAL QGWPLDDPRD GEEPDGESGG PRSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
8 | sodium chloride | natural abundance | 100 (±2.0) mM | |
9 | DTT | natural abundance | 1 (±0.1) mM | |
10 | TRIS | natural abundance | 20 (±0.5) mM | |
11 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
2 | sodium chloride | natural abundance | 100 (±2.0) mM | |
3 | DTT | natural abundance | 1 (±0.1) mM | |
4 | TRIS | natural abundance | 20 (±0.5) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MSMEG_1053 | [U-99% 13C; U-99% 15N] | 1.0 (±0.1) mM | |
8 | sodium chloride | natural abundance | 100 (±2.0) mM | |
9 | DTT | natural abundance | 1 (±0.1) mM | |
10 | TRIS | natural abundance | 20 (±0.5) mM | |
11 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18016_2lky.nef |
Input source #2: Coordindates | 2lky.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREEDIERVRRHLALQGWPLDDPRD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREEDIERVRRHLALQGWPLDDPRD -------110-- GEEPDGESGGPR |||||||||||| GEEPDGESGGPR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 112 | 0 | 0 | 100.0 |
Content subtype: combined_18016_2lky.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREEDIERVRRHLALQGWPLDDPRD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREEDIERVRRHLALQGWPLDDPRD -------110-- GEEPDGESGGPR |||||||||||| GEEPDGESGGPR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 664 | 614 | 92.5 |
13C chemical shifts | 494 | 453 | 91.7 |
15N chemical shifts | 119 | 108 | 90.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 225 | 209 | 92.9 |
13C chemical shifts | 224 | 193 | 86.2 |
15N chemical shifts | 102 | 96 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 439 | 405 | 92.3 |
13C chemical shifts | 270 | 260 | 96.3 |
15N chemical shifts | 17 | 12 | 70.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 65 | 100.0 |
13C chemical shifts | 65 | 65 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 25 | 78.1 |
13C chemical shifts | 30 | 23 | 76.7 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREEDIERVRRHLALQGWPLDDPRD |||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| ...SMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRA.FDHIDIGVLITQMTDEMPREEDIERVRRHLALQGWPLDDPRD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-- GEEPDGESGGPR ||||||| GEEPDGE -------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREEDIERVRRHLALQGWPLDDPRD ||||||||||||| |||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| |||| .......AFLAKIAAWLNAG.PEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRA..DHIDIGVLITQMTDEMPREEDIERVRRHLALQG.PLDD --------10--------20--------30--------40--------50--------60--------70--------80--------90------- -------110-- GEEPDGESGGPR