Solution structure of the yeast Sti1 DP2 domain
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.6 % (820 of 832) | 98.9 % (436 of 441) | 98.1 % (307 of 313) | 98.7 % (77 of 78) |
Backbone | 98.6 % (408 of 414) | 100.0 % (139 of 139) | 97.1 % (204 of 210) | 100.0 % (65 of 65) |
Sidechain | 98.8 % (480 of 486) | 98.3 % (297 of 302) | 100.0 % (171 of 171) | 92.3 % (12 of 13) |
Aromatic | 100.0 % (22 of 22) | 100.0 % (11 of 11) | 100.0 % (11 of 11) | |
Methyl | 100.0 % (74 of 74) | 100.0 % (37 of 37) | 100.0 % (37 of 37) |
1. DP2
QPGTSNETPE ETYQRAMKDP EVAAIMQDPV MQSILQQAQQ NPAALQEHMK NPEVFKKIQT LIAAGIIRTG RSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DP2 | natural abundance | 1 mM | |
8 | potassium chloride | natural abundance | 50 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.2 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DP2 | [U-99% 15N] | 0.5 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.2 w/v | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DP2 | [U-99% 15N] | 0.5 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.2 w/v | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DP2 | natural abundance | 1 mM | |
8 | potassium chloride | natural abundance | 50 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.2 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DP2 | [U-99% 15N] | 0.5 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.2 w/v | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DP2 | [U-99% 15N] | 0.5 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.2 w/v | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DP2 | [U-99% 13C; U-99% 15N] | 0.5-3 mM | |
2 | potassium chloride | natural abundance | 50 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.2 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DP2 | [U-99% 15N] | 0.5 mM | |
14 | potassium chloride | natural abundance | 50 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.2 w/v | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18091_2llw.nef |
Input source #2: Coordindates | 2llw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-520-----530-------540-------550-------560-------570-------580--------- QPGTSNETPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAGIIRTGR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QPGTSNETPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAGIIRTGR --------10--------20--------30--------40--------50--------60--------70-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 71 | 0 | 0 | 100.0 |
Content subtype: combined_18091_2llw.nef
Assigned chemical shifts
-520-----530-------540-------550-------560-------570-------580--------- QPGTSNETPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAGIIRTGR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QPGTSNETPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAGIIRTGR
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
566 | HIS | HD1 | 6.85 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 441 | 432 | 98.0 |
13C chemical shifts | 313 | 307 | 98.1 |
15N chemical shifts | 81 | 76 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 139 | 137 | 98.6 |
13C chemical shifts | 142 | 136 | 95.8 |
15N chemical shifts | 65 | 64 | 98.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 302 | 295 | 97.7 |
13C chemical shifts | 171 | 171 | 100.0 |
15N chemical shifts | 16 | 12 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 41 | 100.0 |
13C chemical shifts | 41 | 41 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 11 | 11 | 100.0 |
13C chemical shifts | 11 | 11 | 100.0 |
Distance restraints
-520-----530-------540-------550-------560-------570-------580--------- QPGTSNETPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAGIIRTGR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......ETPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAGIIRTGR