The NMR structure of a major allergen from dust mite
NTATQRFHEI EKFLLHITHE VDDLEKTGNK DEKARLLREL TVSEAFIEGS RGYFQRELKR TDLDLLEKFN FEAALATGDL LLKDLKALQK RVQDSE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.9 % (928 of 1162) | 86.3 % (525 of 608) | 68.3 % (308 of 451) | 92.2 % (95 of 103) |
Backbone | 82.6 % (476 of 576) | 95.9 % (188 of 196) | 68.0 % (193 of 284) | 99.0 % (95 of 96) |
Sidechain | 79.6 % (540 of 678) | 81.8 % (337 of 412) | 78.4 % (203 of 259) | 0.0 % (0 of 7) |
Aromatic | 0.0 % (0 of 80) | 0.0 % (0 of 40) | 0.0 % (0 of 40) | |
Methyl | 95.7 % (111 of 116) | 100.0 % (58 of 58) | 91.4 % (53 of 58) |
1. entity
NTATQRFHEI EKFLLHITHE VDDLEKTGNK DEKARLLREL TVSEAFIEGS RGYFQRELKR TDLDLLEKFN FEAALATGDL LLKDLKALQK RVQDSESolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 0.8 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | entity | natural abundance | 0.8 ug/mL |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 0.8 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | entity | natural abundance | 0.8 ug/mL |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 0.8 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | entity | natural abundance | 0.8 ug/mL |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 0.8 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | entity | natural abundance | 0.8 ug/mL |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 0.8 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | entity | natural abundance | 0.8 ug/mL |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 0.8 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | entity | natural abundance | 0.8 ug/mL |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 0.8 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | entity | natural abundance | 0.8 ug/mL |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 0.8 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | entity | natural abundance | 0.8 ug/mL |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 0.8 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | entity | natural abundance | 0.8 ug/mL |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 0.8 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | entity | natural abundance | 0.8 ug/mL |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 0.8 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | entity | natural abundance | 0.8 ug/mL |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18107_2lm9.nef |
Input source #2: Coordindates | 2lm9.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110--- NTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE --------10--------20--------30--------40--------50--------60--------70--------80--------90------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 96 | 0 | 0 | 100.0 |
Content subtype: combined_18107_2lm9.nef
Assigned chemical shifts
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110--- NTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 608 | 528 | 86.8 |
15N chemical shifts | 110 | 94 | 85.5 |
13C chemical shifts | 451 | 291 | 64.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 196 | 190 | 96.9 |
15N chemical shifts | 96 | 94 | 97.9 |
13C chemical shifts | 192 | 92 | 47.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 412 | 338 | 82.0 |
15N chemical shifts | 14 | 0 | 0.0 |
13C chemical shifts | 259 | 199 | 76.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 58 | 100.0 |
13C chemical shifts | 58 | 51 | 87.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 0 | 0.0 |
13C chemical shifts | 40 | 0 | 0.0 |
Distance restraints
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110--- NTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE
Dihedral angle restraints
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110--- NTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE |||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||| .TATQRF.EIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATG.LLLKDLKALQKRVQDSE