Structure of T7 transcription factor Gp2-E. coli RNAp jaw domain complex
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 69.9 % (1326 of 1898) | 68.8 % (677 of 984) | 70.7 % (528 of 747) | 72.5 % (121 of 167) |
Backbone | 72.8 % (719 of 988) | 73.9 % (252 of 341) | 71.8 % (351 of 489) | 73.4 % (116 of 158) |
Sidechain | 67.9 % (722 of 1063) | 66.1 % (425 of 643) | 71.0 % (292 of 411) | 55.6 % (5 of 9) |
Aromatic | 58.2 % (99 of 170) | 58.8 % (50 of 85) | 56.1 % (46 of 82) | 100.0 % (3 of 3) |
Methyl | 84.0 % (131 of 156) | 83.3 % (65 of 78) | 84.6 % (66 of 78) |
1. entity 1
MGSSHHHHHH SSGLVPRGSH MSNVNTGSLS VDNKKFWATV ESSEHSFEVP IYAETLDEAL ELAEWQYVPA GFEVTRVRPC VAPK2. entity 2
MGSSHHHHHH SSGLVPRGSH MKEPAILAEI SGIVSFGKET KGKRRLVITP VDGSDPYEEM IPKWRQLNVF EGERVERGDV ISDGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp2-Jaw complex | [U-100% 13C; U-100% 15N] | 300 mM | |
2 | Gp2-Jaw complex | [U-100% 13C; U-100% 15N] | 300 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | NaCl | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | methyl carbon | 0.0 ppm | internal | indirect | 0.25 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | indirect | 0.1 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | methyl carbon | 0.0 ppm | internal | indirect | 0.25 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | indirect | 0.1 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | methyl carbon | 0.0 ppm | internal | indirect | 0.25 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | indirect | 0.1 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | methyl carbon | 0.0 ppm | internal | indirect | 0.25 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | indirect | 0.1 |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Gp2-Jaw complex | [U-100% 13C; U-100% 15N] | 300 mM | |
2 | Gp2-Jaw complex | [U-100% 13C; U-100% 15N] | 300 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % | |
5 | NaCl | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18111_2lmc.nef |
Input source #2: Coordindates | 2lmc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80---- MGSSHHHHHHSSGLVPRGSHMSNVNTGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAPK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMSNVNTGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAPK
--------10--------20--------30--------40--------50--------60--------70--------80---- MGSSHHHHHHSSGLVPRGSHMKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 84 | 0 | 0 | 100.0 |
B | B | 84 | 0 | 0 | 100.0 |
Content subtype: combined_18111_2lmc.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80---- MGSSHHHHHHSSGLVPRGSHMSNVNTGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAPK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........................TGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVA --------10--------20--------30--------40--------50--------60--------70--------80--
--------10--------20--------30--------40--------50--------60--------70--------80---- MGSSHHHHHHSSGLVPRGSHMKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......................PAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 483 | 305 | 63.1 |
13C chemical shifts | 374 | 242 | 64.7 |
15N chemical shifts | 88 | 56 | 63.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 168 | 108 | 64.3 |
13C chemical shifts | 168 | 105 | 62.5 |
15N chemical shifts | 79 | 53 | 67.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 315 | 197 | 62.5 |
13C chemical shifts | 206 | 137 | 66.5 |
15N chemical shifts | 9 | 3 | 33.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 32 | 76.2 |
13C chemical shifts | 42 | 33 | 78.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 31 | 60.8 |
13C chemical shifts | 49 | 28 | 57.1 |
15N chemical shifts | 2 | 2 | 100.0 |
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
64 | TRP | CD2 | 127.915 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 501 | 329 | 65.7 |
13C chemical shifts | 373 | 256 | 68.6 |
15N chemical shifts | 88 | 57 | 64.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 173 | 121 | 69.9 |
13C chemical shifts | 168 | 118 | 70.2 |
15N chemical shifts | 79 | 56 | 70.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 328 | 208 | 63.4 |
13C chemical shifts | 205 | 138 | 67.3 |
15N chemical shifts | 9 | 1 | 11.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 32 | 78.0 |
13C chemical shifts | 41 | 32 | 78.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 17 | 50.0 |
13C chemical shifts | 33 | 16 | 48.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80---- MGSSHHHHHHSSGLVPRGSHMSNVNTGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAPK | |||||||||||||||||||||||||||||||||||||||||||||||||||||||| M........................TGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCV --------10--------20--------30--------40--------50--------60--------70--------80-
--------10--------20--------30--------40--------50--------60--------70--------80---- MGSSHHHHHHSSGLVPRGSHMKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......................PAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80---- MGSSHHHHHHSSGLVPRGSHMSNVNTGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCVAPK ||||||||||||||||||||||||||||||||||||||||||||||||| ................................NKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPCV --------10--------20--------30--------40--------50--------60--------70--------80-
--------10--------20--------30--------40--------50--------60--------70--------80---- MGSSHHHHHHSSGLVPRGSHMKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG |||| |||||||||||||| |||||||||| ||||||| ||||||||||||||||||||||| .....................KEPA.LAEISGIVSFGKET..KRRLVITPVD.SDPYEEM.PKWRQLNVFEGERVERGDVISDG