BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	93.3 % (753 of 807)	97.4 % (409 of 420)	87.8 % (274 of 312)	93.3 % (70 of 75)
Backbone	92.7 % (391 of 422)	96.0 % (144 of 150)	90.1 % (183 of 203)	92.8 % (64 of 69)
Sidechain	94.4 % (421 of 446)	98.1 % (265 of 270)	88.2 % (150 of 170)	100.0 % (6 of 6)
Aromatic	59.1 % (26 of 44)	95.5 % (21 of 22)	22.7 % (5 of 22)
Methyl	100.0 % (80 of 80)	100.0 % (40 of 40)	100.0 % (40 of 40)

1. CdnL N-terminal domain

AGHMQTSFKT GDKAVYPGQG VGEVMGIEHT EVAGQRQSFY VLRILENGMR IMIPINKVGS VGLREIISEE D

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
1	CdnL N-terminal domain	natural abundance	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.05 %
5	DSS	natural abundance	0.5 mM

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
6	CdnL N-terminal domain	natural abundance	1 mM
7	sodium phosphate	natural abundance	50 mM
8	sodium chloride	natural abundance	100 mM
9	sodium azide	natural abundance	0.05 %
10	DSS	natural abundance	0.5 mM

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

Sample #4

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
16	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
17	sodium phosphate	natural abundance	50 mM
18	sodium chloride	natural abundance	100 mM
19	sodium azide	natural abundance	0.05 %
20	DSS	natural abundance	0.5 mM

Sample #5

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	0.5 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.25 mM

Chem. Shift Complete2

Sequence coverage: 97.2 %, Completeness: 75.1 %, Completeness (bb): 85.7 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	75.1 % (1212 of 1614)	72.3 % (607 of 840)	74.5 % (465 of 624)	93.3 % (140 of 150)
Backbone	85.7 % (723 of 844)	83.3 % (250 of 300)	85.0 % (345 of 406)	92.8 % (128 of 138)
Sidechain	65.9 % (588 of 892)	66.1 % (357 of 540)	64.4 % (219 of 340)	100.0 % (12 of 12)
Aromatic	39.8 % (35 of 88)	68.2 % (30 of 44)	11.4 % (5 of 44)
Methyl	68.1 % (109 of 160)	68.8 % (55 of 80)	67.5 % (54 of 80)

1. CdnL N-terminal domain

AGHMQTSFKT GDKAVYPGQG VGEVMGIEHT EVAGQRQSFY VLRILENGMR IMIPINKVGS VGLREIISEE D

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
1	CdnL N-terminal domain	natural abundance	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.05 %
5	DSS	natural abundance	0.5 mM

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
6	CdnL N-terminal domain	natural abundance	1 mM
7	sodium phosphate	natural abundance	50 mM
8	sodium chloride	natural abundance	100 mM
9	sodium azide	natural abundance	0.05 %
10	DSS	natural abundance	0.5 mM

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

Sample #4

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
16	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
17	sodium phosphate	natural abundance	50 mM
18	sodium chloride	natural abundance	100 mM
19	sodium azide	natural abundance	0.05 %
20	DSS	natural abundance	0.5 mM

Sample #5

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	0.5 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.25 mM

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.26 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.26 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.38 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2LT4, Strand ID: A Detail

Release date

2012-03-08

Citation

(1)H, (13)C and (15)N assignments of CdnL, an essential protein in Myxococcus xanthus
Mirassou, Y., Elias-Arnanz, M., Padmanabhan, S., Jimenez, M.
Biomol. NMR Assign. (2013), 7, 51-55, PubMed 22392343 , DOI 10.1007/s12104-012-9375-0 , Abstract

Entries sharing articles BMRB: 1 entries Detail

BMRB: 18151 released on 2012-03-08
Title 1H, 13C, and 15N chemical shift assignments for CdnL from Myxoccoccus xanthus

Related entities 1. CdnL N-terminal domain, : 1 : 1 : 15 entities Detail

Experiments performed 26 experiments Detail

1 2D 1H-1H COSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
1	CdnL N-terminal domain	natural abundance	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.05 %
5	DSS	natural abundance	0.5 mM

2 2D 1H-1H TOCSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
1	CdnL N-terminal domain	natural abundance	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.05 %
5	DSS	natural abundance	0.5 mM

3 2D 1H-1H NOESY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
1	CdnL N-terminal domain	natural abundance	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.05 %
5	DSS	natural abundance	0.5 mM

4 2D 1H-1H COSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
6	CdnL N-terminal domain	natural abundance	1 mM
7	sodium phosphate	natural abundance	50 mM
8	sodium chloride	natural abundance	100 mM
9	sodium azide	natural abundance	0.05 %
10	DSS	natural abundance	0.5 mM

5 2D 1H-1H TOCSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
6	CdnL N-terminal domain	natural abundance	1 mM
7	sodium phosphate	natural abundance	50 mM
8	sodium chloride	natural abundance	100 mM
9	sodium azide	natural abundance	0.05 %
10	DSS	natural abundance	0.5 mM

6 2D 1H-1H NOESY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
6	CdnL N-terminal domain	natural abundance	1 mM
7	sodium phosphate	natural abundance	50 mM
8	sodium chloride	natural abundance	100 mM
9	sodium azide	natural abundance	0.05 %
10	DSS	natural abundance	0.5 mM

7 2D 1H-15N HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

8 3D HNCO

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

9 3D HNCA

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

10 3D HNCACB

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

11 3D CBCA(CO)NH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

12 3D HBHA(CO)NH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

13 2D 1H-13C HSQC aliphatic

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
16	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
17	sodium phosphate	natural abundance	50 mM
18	sodium chloride	natural abundance	100 mM
19	sodium azide	natural abundance	0.05 %
20	DSS	natural abundance	0.5 mM

14 3D HCCH-TOCSY

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
16	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
17	sodium phosphate	natural abundance	50 mM
18	sodium chloride	natural abundance	100 mM
19	sodium azide	natural abundance	0.05 %
20	DSS	natural abundance	0.5 mM

15 3D 1H-13C NOESY aliphatic

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
16	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
17	sodium phosphate	natural abundance	50 mM
18	sodium chloride	natural abundance	100 mM
19	sodium azide	natural abundance	0.05 %
20	DSS	natural abundance	0.5 mM

16 2D 1H-15N HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	0.5 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.25 mM

17 3D HNCA

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	0.5 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.25 mM

18 3D CBCA(CO)NH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	0.5 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.25 mM

19 3D HBHA(CO)NH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	0.5 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.25 mM

20 2D 1H-15N HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

21 3D HNCO

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

22 3D HNCA

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

23 3D HNCACB

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

24 3D CBCA(CO)NH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

25 3D HBHA(CO)NH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
11	CdnL N-terminal domain	[U-100% 13C; U-100% 15N]	1 mM
12	sodium phosphate	natural abundance	50 mM
13	sodium chloride	natural abundance	100 mM
14	sodium azide	natural abundance	0.05 %
15	DSS	natural abundance	0.5 mM

26 2D 1H-13C HSQC aromatic

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
6	CdnL N-terminal domain	natural abundance	1 mM
7	sodium phosphate	natural abundance	50 mM
8	sodium chloride	natural abundance	100 mM
9	sodium azide	natural abundance	0.05 %
10	DSS	natural abundance	0.5 mM

NMR combined restraints 5 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_18121_2lt4.nef
Input source #2: Coordindates	2lt4.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70-
AGHMQTSFKTGDKAVYPGQGVGEVMGIEHTEVAGQRQSFYVLRILENGMRIMIPINKVGSVGLREIISEED
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
AGHMQTSFKTGDKAVYPGQGVGEVMGIEHTEVAGQRQSFYVLRILENGMRIMIPINKVGSVGLREIISEED

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	71	0	0	100.0

Content subtype: combined_18121_2lt4.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	747		98.6 (chain: A, length: 71)
2	Assigned chemical shifts	assigned_chem_shift_list_2	Warning	360		95.8 (chain: A, length: 71)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	OK	734 (1)	noe	87.3 (chain: A, length: 71)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_3	OK	111 (111)	.	94.4 (chain: A, length: 71)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 71, Sequence coverage: 98.6%
- Total number of assignments
  - ¹H chemical shifts: 408
  - ¹³C chemical shifts: 271
  - ¹⁵N chemical shifts: 68
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A
Saveframe: assigned_chem_shift_list_2
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 71, Sequence coverage: 95.8%
- Total number of assignments
  - ¹H chemical shifts: 130
  - ¹³C chemical shifts: 160
  - ¹⁵N chemical shifts: 70
- Completeness of assignments
  - Entity_assemble_ID: A
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
5	GLN	CD	180.399
35	GLN	CD	180.577
37	GLN	CD	180.06
56	ASN	CG	177.173

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	420	408	97.1
¹³C chemical shifts	312	267	85.6
¹⁵N chemical shifts	79	68	86.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	150	143	95.3
¹³C chemical shifts	142	118	83.1
¹⁵N chemical shifts	69	62	89.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	270	265	98.1
¹³C chemical shifts	170	149	87.6
¹⁵N chemical shifts	10	6	60.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	44	44	100.0
¹³C chemical shifts	44	44	100.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	22	21	95.5
¹³C chemical shifts	22	4	18.2

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 71, Sequence coverage: 87.3%
- Total number of restraints: 734
- Weight of restraints: 1.0 (734)
- Potential type of restraints: upper-bound-parabolic (734)
- Range of distance target values: 2.28, 5.5 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 71, Sequence coverage: 94.4%
- Total number of restraints: 111
- Total number of restraints per polymer type: 111
- Weight of restraints: 1.0 (111)
- Potential type of restraints: square-well-parabolic (111)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords CarD_TRCF, CdnL, Myxococcus xanthus, PF02559, RNA polymerase interacting domain

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
36	ARG	CZ	159.361
43	ARG	CZ	159.42
64	ARG	CZ	159.49

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	420	130	31.0
¹³C chemical shifts	312	157	50.3
¹⁵N chemical shifts	79	70	88.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	150	91	60.7
¹³C chemical shifts	142	117	82.4
¹⁵N chemical shifts	69	61	88.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	270	39	14.4
¹³C chemical shifts	170	40	23.5
¹⁵N chemical shifts	10	9	90.0

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.661 seconds)

BMRB: 18121

Sample #1

Sample #2

Sample #3

Sample #4

Sample #5

Sample #1

Sample #2

Sample #3

Sample #4

Sample #5

Chemical shift reference

Chemical shift reference

Chemical shift reference

Entries sharing articles BMRB: 1 entries Detail

Related entities 1. CdnL N-terminal domain, : 1 : 1 : 15 entities Detail

Experiments performed 26 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument