BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	69.0 % (800 of 1159)	77.0 % (466 of 605)	56.1 % (250 of 446)	77.8 % (84 of 108)
Backbone	63.8 % (383 of 600)	75.7 % (159 of 210)	51.4 % (150 of 292)	75.5 % (74 of 98)
Sidechain	75.2 % (488 of 649)	77.7 % (307 of 395)	70.1 % (171 of 244)	100.0 % (10 of 10)
Aromatic	42.9 % (36 of 84)	66.7 % (28 of 42)	17.1 % (7 of 41)	100.0 % (1 of 1)
Methyl	88.0 % (88 of 100)	88.0 % (44 of 50)	88.0 % (44 of 50)

1. entity

MGSSHHHHHH SSGLVPRGSH MISGLRTLEQ SVGEWLESIG LQQYESKLLL NGFDDVHFLG SNVMEEQDLR DIGISDPQHR RKLLQAARSL PKVKALGYDG N

Show sample condition

Sample #1

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 13C; U-100% 15N]	0.9 ~ 1.0 mM
2	potassium chloride	natural abundance	2.7 mM
3	potassium phosphate	natural abundance	1.8 mM
4	sodium chloride	natural abundance	140 mM
5	sodium phosphate	natural abundance	10 mM
6	sodium azide	natural abundance	0.2 %
7	H2O	natural abundance	95 %
8	D2O	99%	5 %

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
9	entity	natural abundance	0.9 ~ 1.0 mM
10	potassium chloride	natural abundance	2.7 mM
11	potassium phosphate	natural abundance	1.8 mM
12	sodium chloride	natural abundance	140 mM
13	sodium phosphate	natural abundance	10 mM
14	sodium azide	natural abundance	0.2 %
15	D2O	99%	100 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.45 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.45 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.0 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2LMR, Strand ID: A Detail

Release date

2012-01-24

Citation

Solution structure of the first Sam domain of Odin and binding studies with the EphA2 receptor
Mercurio, F., Marasco, D., Pirone, L., Pedone, E., Pellecchia, M., Leone, M.
Biochemistry (2012), 51, 2136-2145, PubMed 22332920 , DOI 10.1021/bi300141h , Abstract

Entries sharing articles Swiss-Prot: 2 entries Detail

  Swiss-Prot: Q92625 released on 2003-05-09
    Title ANS1A_HUMAN Entity Ankyrin repeat and SAM domain-containing protein 1A
  Swiss-Prot: P29317 released on 1992-12-01
    Title EPHA2_HUMAN Entity Ephrin type-A receptor 2

Related entities 1. FIRST SAM DOMAIN OF ODIN, : 1 : 19 entities Detail

Experiments performed 11 experiments Detail

1 2D 1H-15N HSQC

Instrument

Varian Unity - 600 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 13C; U-100% 15N]	0.9 ~ 1.0 mM
2	potassium chloride	natural abundance	2.7 mM
3	potassium phosphate	natural abundance	1.8 mM
4	sodium chloride	natural abundance	140 mM
5	sodium phosphate	natural abundance	10 mM
6	sodium azide	natural abundance	0.2 %
7	H2O	natural abundance	95 %
8	D2O	99%	5 %

2 2D 1H-13C HSQC

Instrument

Varian Unity - 600 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 13C; U-100% 15N]	0.9 ~ 1.0 mM
2	potassium chloride	natural abundance	2.7 mM
3	potassium phosphate	natural abundance	1.8 mM
4	sodium chloride	natural abundance	140 mM
5	sodium phosphate	natural abundance	10 mM
6	sodium azide	natural abundance	0.2 %
7	H2O	natural abundance	95 %
8	D2O	99%	5 %

3 2D 1H-1H TOCSY

Instrument

Varian Unity - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
9	entity	natural abundance	0.9 ~ 1.0 mM
10	potassium chloride	natural abundance	2.7 mM
11	potassium phosphate	natural abundance	1.8 mM
12	sodium chloride	natural abundance	140 mM
13	sodium phosphate	natural abundance	10 mM
14	sodium azide	natural abundance	0.2 %
15	D2O	99%	100 %

4 2D 1H-1H NOESY

Instrument

Varian Unity - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
9	entity	natural abundance	0.9 ~ 1.0 mM
10	potassium chloride	natural abundance	2.7 mM
11	potassium phosphate	natural abundance	1.8 mM
12	sodium chloride	natural abundance	140 mM
13	sodium phosphate	natural abundance	10 mM
14	sodium azide	natural abundance	0.2 %
15	D2O	99%	100 %

5 3D CBCA(CO)NH

Instrument

Varian Unity - 600 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 13C; U-100% 15N]	0.9 ~ 1.0 mM
2	potassium chloride	natural abundance	2.7 mM
3	potassium phosphate	natural abundance	1.8 mM
4	sodium chloride	natural abundance	140 mM
5	sodium phosphate	natural abundance	10 mM
6	sodium azide	natural abundance	0.2 %
7	H2O	natural abundance	95 %
8	D2O	99%	5 %

6 3D C(CO)NH

Instrument

Varian Unity - 600 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 13C; U-100% 15N]	0.9 ~ 1.0 mM
2	potassium chloride	natural abundance	2.7 mM
3	potassium phosphate	natural abundance	1.8 mM
4	sodium chloride	natural abundance	140 mM
5	sodium phosphate	natural abundance	10 mM
6	sodium azide	natural abundance	0.2 %
7	H2O	natural abundance	95 %
8	D2O	99%	5 %

7 3D HNCA

Instrument

Varian Unity - 600 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 13C; U-100% 15N]	0.9 ~ 1.0 mM
2	potassium chloride	natural abundance	2.7 mM
3	potassium phosphate	natural abundance	1.8 mM
4	sodium chloride	natural abundance	140 mM
5	sodium phosphate	natural abundance	10 mM
6	sodium azide	natural abundance	0.2 %
7	H2O	natural abundance	95 %
8	D2O	99%	5 %

8 3D HNCACB

Instrument

Varian Unity - 600 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 13C; U-100% 15N]	0.9 ~ 1.0 mM
2	potassium chloride	natural abundance	2.7 mM
3	potassium phosphate	natural abundance	1.8 mM
4	sodium chloride	natural abundance	140 mM
5	sodium phosphate	natural abundance	10 mM
6	sodium azide	natural abundance	0.2 %
7	H2O	natural abundance	95 %
8	D2O	99%	5 %

9 3D HCCH-TOCSY

Instrument

Varian Unity - 600 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 13C; U-100% 15N]	0.9 ~ 1.0 mM
2	potassium chloride	natural abundance	2.7 mM
3	potassium phosphate	natural abundance	1.8 mM
4	sodium chloride	natural abundance	140 mM
5	sodium phosphate	natural abundance	10 mM
6	sodium azide	natural abundance	0.2 %
7	H2O	natural abundance	95 %
8	D2O	99%	5 %

10 3D 1H-15N NOESY

Instrument

Varian Unity - 600 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 13C; U-100% 15N]	0.9 ~ 1.0 mM
2	potassium chloride	natural abundance	2.7 mM
3	potassium phosphate	natural abundance	1.8 mM
4	sodium chloride	natural abundance	140 mM
5	sodium phosphate	natural abundance	10 mM
6	sodium azide	natural abundance	0.2 %
7	H2O	natural abundance	95 %
8	D2O	99%	5 %

11 3D 1H-13C NOESY

Instrument

Varian Unity - 600 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7

#	Name	Isotope labeling	Concentration
1	entity	[U-100% 13C; U-100% 15N]	0.9 ~ 1.0 mM
2	potassium chloride	natural abundance	2.7 mM
3	potassium phosphate	natural abundance	1.8 mM
4	sodium chloride	natural abundance	140 mM
5	sodium phosphate	natural abundance	10 mM
6	sodium azide	natural abundance	0.2 %
7	H2O	natural abundance	95 %
8	D2O	99%	5 %

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_18134_2lmr.nef
Input source #2: Coordindates	2lmr.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MGSSHHHHHHSSGLVPRGSHMISGLRTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDG
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MGSSHHHHHHSSGLVPRGSHMISGLRTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDG

-
N
|
N

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	101	0	0	100.0

Content subtype: combined_18134_2lmr.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	789		77.2 (chain: A, length: 101)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	OK	1679 (1)	noe	70.3 (chain: A, length: 101)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_3	Warning	372 (367)	.	80.2 (chain: A, length: 101)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 77.2%
- Total number of assignments
  - ¹H chemical shifts: 464
  - ¹³C chemical shifts: 244
  - ¹⁵N chemical shifts: 81
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	605	464	76.7
¹³C chemical shifts	446	244	54.7
¹⁵N chemical shifts	114	81	71.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	210	157	74.8
¹³C chemical shifts	202	75	37.1
¹⁵N chemical shifts	98	71	72.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	395	307	77.7
¹³C chemical shifts	244	169	69.3
¹⁵N chemical shifts	16	10	62.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	53	45	84.9
¹³C chemical shifts	53	45	84.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	42	28	66.7
¹³C chemical shifts	41	7	17.1
¹⁵N chemical shifts	1	1	100.0

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 70.3%
- Total number of restraints: 1677
- Weight of restraints: 1.0 (1677)
- Potential type of restraints: upper-bound-parabolic (1677)
- Range of distance target values: 2.55, 8.65 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_3
- Status: Warning
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 80.2%
- Total number of restraints: 367
- Total number of restraints per polymer type: 367
- Weight of restraints: 1.0 (367)
- Potential type of restraints: square-well-parabolic (367)
- Plot of Phi-Psi angle restraints
- Plot of Chi1-Chi2 angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords SIGNALING PROTEIN

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.957 seconds)

BMRB: 18134

Sample #1

Sample #2

Chemical shift reference

Chemical shift reference

Chemical shift reference

Entries sharing articles Swiss-Prot: 2 entries Detail

Related entities 1. FIRST SAM DOMAIN OF ODIN, : 1 : 19 entities Detail

Experiments performed 11 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail