SOLUTION STRUCTURE OF THE FIRST SAM DOMAIN OF ODIN
MGSSHHHHHH SSGLVPRGSH MISGLRTLEQ SVGEWLESIG LQQYESKLLL NGFDDVHFLG SNVMEEQDLR DIGISDPQHR RKLLQAARSL PKVKALGYDG N
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 69.0 % (800 of 1159) | 77.0 % (466 of 605) | 56.1 % (250 of 446) | 77.8 % (84 of 108) |
Backbone | 63.8 % (383 of 600) | 75.7 % (159 of 210) | 51.4 % (150 of 292) | 75.5 % (74 of 98) |
Sidechain | 75.2 % (488 of 649) | 77.7 % (307 of 395) | 70.1 % (171 of 244) | 100.0 % (10 of 10) |
Aromatic | 42.9 % (36 of 84) | 66.7 % (28 of 42) | 17.1 % (7 of 41) | 100.0 % (1 of 1) |
Methyl | 88.0 % (88 of 100) | 88.0 % (44 of 50) | 88.0 % (44 of 50) |
1. entity
MGSSHHHHHH SSGLVPRGSH MISGLRTLEQ SVGEWLESIG LQQYESKLLL NGFDDVHFLG SNVMEEQDLR DIGISDPQHR RKLLQAARSL PKVKALGYDG NSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | potassium chloride | natural abundance | 2.7 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | sodium phosphate | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.2 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 99% | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | natural abundance | 0.9 ~ 1.0 mM | |
10 | potassium chloride | natural abundance | 2.7 mM | |
11 | potassium phosphate | natural abundance | 1.8 mM | |
12 | sodium chloride | natural abundance | 140 mM | |
13 | sodium phosphate | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.2 % | |
15 | D2O | 99% | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian Unity - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | potassium chloride | natural abundance | 2.7 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | sodium phosphate | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.2 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 99% | 5 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | potassium chloride | natural abundance | 2.7 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | sodium phosphate | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.2 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 99% | 5 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | natural abundance | 0.9 ~ 1.0 mM | |
10 | potassium chloride | natural abundance | 2.7 mM | |
11 | potassium phosphate | natural abundance | 1.8 mM | |
12 | sodium chloride | natural abundance | 140 mM | |
13 | sodium phosphate | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.2 % | |
15 | D2O | 99% | 100 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | natural abundance | 0.9 ~ 1.0 mM | |
10 | potassium chloride | natural abundance | 2.7 mM | |
11 | potassium phosphate | natural abundance | 1.8 mM | |
12 | sodium chloride | natural abundance | 140 mM | |
13 | sodium phosphate | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.2 % | |
15 | D2O | 99% | 100 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | potassium chloride | natural abundance | 2.7 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | sodium phosphate | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.2 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 99% | 5 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | potassium chloride | natural abundance | 2.7 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | sodium phosphate | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.2 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 99% | 5 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | potassium chloride | natural abundance | 2.7 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | sodium phosphate | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.2 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 99% | 5 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | potassium chloride | natural abundance | 2.7 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | sodium phosphate | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.2 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 99% | 5 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | potassium chloride | natural abundance | 2.7 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | sodium phosphate | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.2 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 99% | 5 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | potassium chloride | natural abundance | 2.7 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | sodium phosphate | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.2 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 99% | 5 % |
Varian Unity - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.9 ~ 1.0 mM | |
2 | potassium chloride | natural abundance | 2.7 mM | |
3 | potassium phosphate | natural abundance | 1.8 mM | |
4 | sodium chloride | natural abundance | 140 mM | |
5 | sodium phosphate | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.2 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | 99% | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18134_2lmr.nef |
Input source #2: Coordindates | 2lmr.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMISGLRTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGSSHHHHHHSSGLVPRGSHMISGLRTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDG - N | N
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 101 | 0 | 0 | 100.0 |
Content subtype: combined_18134_2lmr.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMISGLRTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDG || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....................IS..RTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDG - N | N
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 605 | 464 | 76.7 |
13C chemical shifts | 446 | 244 | 54.7 |
15N chemical shifts | 114 | 81 | 71.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 210 | 157 | 74.8 |
13C chemical shifts | 202 | 75 | 37.1 |
15N chemical shifts | 98 | 71 | 72.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 395 | 307 | 77.7 |
13C chemical shifts | 244 | 169 | 69.3 |
15N chemical shifts | 16 | 10 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 45 | 84.9 |
13C chemical shifts | 53 | 45 | 84.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 28 | 66.7 |
13C chemical shifts | 41 | 7 | 17.1 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMISGLRTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDG | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....................I....TLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKAL --------10--------20--------30--------40--------50--------60--------70--------80--------90------ - N
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGSSHHHHHHSSGLVPRGSHMISGLRTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....................MISGLRTLEQSVGEWLESIGLQQYESKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDG - N | N