A single GalNAc residue on Threonine-106 modifies the dynamics and the structure of Interferon alpha-2a around the glycosylation site.
CDLPQTHSLG SRRTLMLLAQ MRKISLFSCL KDRHDFGFPQ EEFGNQFQKA ETIPVLHEMI QQIFNLFSTK DSSAAWDETL LDKFYTELYQ QLNDLEACVI QGVGVTETPL MKEDSILAVR KYFQRITLYL KEKKYSPCAW EVVRAEIMRS FSLSTNLQES LRSKE
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS1:SG | 1:CYS98:SG |
2 | disulfide | sing | 1:CYS29:SG | 1:CYS138:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.7 % (1929 of 2016) | 96.4 % (1016 of 1054) | 93.8 % (735 of 784) | 100.0 % (178 of 178) |
Backbone | 99.4 % (974 of 980) | 100.0 % (330 of 330) | 98.8 % (484 of 490) | 100.0 % (160 of 160) |
Sidechain | 93.2 % (1115 of 1196) | 94.8 % (686 of 724) | 90.5 % (411 of 454) | 100.0 % (18 of 18) |
Aromatic | 77.8 % (137 of 176) | 88.6 % (78 of 88) | 66.3 % (57 of 86) | 100.0 % (2 of 2) |
Methyl | 100.0 % (180 of 180) | 100.0 % (90 of 90) | 100.0 % (90 of 90) |
1. Interferon Alpha-2a
CDLPQTHSLG SRRTLMLLAQ MRKISLFSCL KDRHDFGFPQ EEFGNQFQKA ETIPVLHEMI QQIFNLFSTK DSSAAWDETL LDKFYTELYQ QLNDLEACVI QGVGVTETPL MKEDSILAVR KYFQRITLYL KEKKYSPCAW EVVRAEIMRS FSLSTNLQES LRSKESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | Denaturated Sodium Acetate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.53 mM | |
6 | Deuturated Sodium Acetate | natural abundance | 25 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.87 mM | |
10 | Deuturated Sodium Acetate | natural abundance | 25 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | Denaturated Sodium Acetate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | Denaturated Sodium Acetate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | Denaturated Sodium Acetate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | Denaturated Sodium Acetate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | Denaturated Sodium Acetate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | Denaturated Sodium Acetate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | Denaturated Sodium Acetate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.87 mM | |
10 | Deuturated Sodium Acetate | natural abundance | 25 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.87 mM | |
10 | Deuturated Sodium Acetate | natural abundance | 25 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | Denaturated Sodium Acetate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.87 mM | |
10 | Deuturated Sodium Acetate | natural abundance | 25 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.87 mM | |
10 | Deuturated Sodium Acetate | natural abundance | 25 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.85 mM | |
2 | Denaturated Sodium Acetate | natural abundance | 25 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298.15 K, pH 3.5, Details Buffer: 25mM Deuturated Sodium Acetate at pH 3.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | Interferon Alpha-2a (O-glycosylated) | [U-100% 13C; U-100% 15N] | 0.87 mM | |
10 | Deuturated Sodium Acetate | natural abundance | 25 mM | |
11 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18135_2lms.nef |
Input source #2: Coordindates | 2lms.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:1:CYS:SG | A:98:CYS:SG | oxidized, CA 55.949, CB 41.684 ppm | oxidized, CA 57.166, CB 41.879 ppm | 2.141 |
A:29:CYS:SG | A:138:CYS:SG | oxidized, CA 53.43, CB 37.242 ppm | oxidized, CA 57.095, CB 36.779 ppm | 1.946 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:107:THR:OG1 | 2:1:A2G:C1 | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | A2G | 2-acetamido-2-deoxy-alpha-D-galactopyranose | Assigned chemical shifts |
Sequence alignments
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 MCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------110-------120-------130-------140-------150-------160----- IQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| IQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE -------110-------120-------130-------140-------150-------160------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 166 | 0 | 0 | 100.0 |
Content subtype: combined_18135_2lms.nef
Assigned chemical shifts
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 MCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACV 0-------110-------120-------130-------140-------150-------160----- IQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| IQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
- X | X
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1061 | 1003 | 94.5 |
13C chemical shifts | 789 | 730 | 92.5 |
15N chemical shifts | 188 | 178 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 332 | 330 | 99.4 |
13C chemical shifts | 332 | 324 | 97.6 |
15N chemical shifts | 161 | 160 | 99.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 729 | 673 | 92.3 |
13C chemical shifts | 457 | 406 | 88.8 |
15N chemical shifts | 27 | 18 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 96 | 95 | 99.0 |
13C chemical shifts | 96 | 95 | 99.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 88 | 78 | 88.6 |
13C chemical shifts | 86 | 57 | 66.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 9 | 2 | 22.2 |
13C chemical shifts | 8 | 1 | 12.5 |
15N chemical shifts | 1 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 7 | 1 | 14.3 |
13C chemical shifts | 6 | 1 | 16.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 2 | 1 | 50.0 |
13C chemical shifts | 2 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1 | 1 | 100.0 |
13C chemical shifts | 1 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Covalent bonds
Distance restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 MCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACV |||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGF.QEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACV 0-------110-------120-------130-------140-------150-------160----- IQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| IQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Dihedral angle restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 MCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACV |||||||||||||||||||||||||||| |||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||| .....QTHSLGSRRTLMLLAQMRKISLFSCLKD....GFPQEEFG.QFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACV 0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 0-------110-------120-------130-------140-------150-------160----- IQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE || |||||||||||||||||||||||||||||||||||||||||||||||||||||| IQ....TETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQE 0-------110-------120-------130-------140-------150---------