BMRBj - BMREntryMaster

Found 1 Document (2.255 seconds)

BMRB: 18156

2LNA

Solution NMR Structure of the mitochondrial inner membrane domain (residues 164-251), FtsH_ext, from the paraplegin-like protein AFGL32 from Homo sapiens, Northeast Structural Genomics Consortium Target HR6741A

Authors

Ramelot, T.A., Yang, Y., Lee, H., Janua, H., Kohan, E., Shastry, R., Acton, T.B., Xiao, R., Everett, J.K., Prestegard, J.H., Montelione, G.T., Kennedy, M.A.

Assembly

HR6741A

Entity

1. HR6741A (polymer, Thiol state: not present), 99 monomers, 11474.71 Da Detail

MGHHHHHHSH MKRSGREITW KDFVNNYLSK GVVDRLEVVN KRFVRVTFTP GKTPVDGQYV WFNIGSVDTF ERNLETLQQE LGIEGENRVP VVYIAESDG

Formula weight

11474.71 Da

Source organism

Homo sapiens

Exptl. method

solution NMR

Refine. method

simulated annealing

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 93.9 %, Completeness: 90.5 %, Completeness (bb): 90.5 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	90.5 % (1063 of 1174)	90.8 % (553 of 609)	89.7 % (411 of 458)	92.5 % (99 of 107)
Backbone	90.5 % (532 of 588)	91.2 % (186 of 204)	89.6 % (258 of 288)	91.7 % (88 of 96)
Sidechain	90.7 % (613 of 676)	90.6 % (367 of 405)	90.4 % (235 of 260)	100.0 % (11 of 11)
Aromatic	77.8 % (98 of 126)	77.8 % (49 of 63)	77.0 % (47 of 61)	100.0 % (2 of 2)
Methyl	100.0 % (102 of 102)	100.0 % (51 of 51)	100.0 % (51 of 51)

1. HR6741A

MGHHHHHHSH MKRSGREITW KDFVNNYLSK GVVDRLEVVN KRFVRVTFTP GKTPVDGQYV WFNIGSVDTF ERNLETLQQE LGIEGENRVP VVYIAESDG

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM NC5 HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
10	HR6741A	NC5	1.0 mM
11	sodium chloride	natural abundance	200 mM
12	MES	natural abundance	20 mM
13	calcium chloride	natural abundance	5 mM
14	DTT	natural abundance	10 mM
15	DSS	natural abundance	10 uM
16	sodium azide	natural abundance	0.02 %
17	H2O	natural abundance	90 %
18	D2O	natural abundance	10 %

Sample #3

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 100% D2O

#	Name	Isotope labeling	Concentration
19	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
20	sodium chloride	natural abundance	200 mM
21	MES	natural abundance	20 mM
22	calcium chloride	natural abundance	5 mM
23	DTT	natural abundance	10 mM
24	DSS	natural abundance	10 uM
25	sodium azide	natural abundance	0.02 %
26	D2O	natural abundance	100 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.08 ppm, Outliers: 3 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.08 ppm, Outliers: 3 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.06 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.15 ppm, Outliers: 2 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2LNA, Strand ID: A Detail

Release date

2012-02-05

Related entities 1. HR6741A, : 1 : 4 : 41 entities Detail

Interaction partners 1. HR6741A, : 47 interactors Detail

More details for 47 interactors identified by 25 citations

Experiments performed 19 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker AvanceIII - 850 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

2 2D 1H-13C HSQC

Instrument

Bruker AvanceIII - 850 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

3 3D HNCO

Instrument

Varian INOVA - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

4 3D CBCA(CO)NH

Instrument

Varian INOVA - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

5 3D HNCACB

Instrument

Varian INOVA - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

6 3D 1H-13C arom NOESY

Instrument

Bruker AvanceIII - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

7 3D 1H-13C NOESYaliph

Instrument

Bruker AvanceIII - 850 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

8 3D 1H-15N NOESY

Instrument

Bruker AvanceIII - 850 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

9 2D 1H-13C HSQC aliphatic

Instrument

Bruker AvanceIII - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM NC5 HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
10	HR6741A	NC5	1.0 mM
11	sodium chloride	natural abundance	200 mM
12	MES	natural abundance	20 mM
13	calcium chloride	natural abundance	5 mM
14	DTT	natural abundance	10 mM
15	DSS	natural abundance	10 uM
16	sodium azide	natural abundance	0.02 %
17	H2O	natural abundance	90 %
18	D2O	natural abundance	10 %

10 2D 1H-15N hetNOE

Instrument

Bruker AvanceIII - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM NC5 HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
10	HR6741A	NC5	1.0 mM
11	sodium chloride	natural abundance	200 mM
12	MES	natural abundance	20 mM
13	calcium chloride	natural abundance	5 mM
14	DTT	natural abundance	10 mM
15	DSS	natural abundance	10 uM
16	sodium azide	natural abundance	0.02 %
17	H2O	natural abundance	90 %
18	D2O	natural abundance	10 %

11 3D HN(CO)CA

Instrument

Varian INOVA - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

12 3D HCCH-TOCSY

Instrument

Varian INOVA - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

13 3D HCCH-COSY

Instrument

Bruker AvanceIII - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

14 3D H(CCO)NH

Instrument

Varian INOVA - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

15 3D C(CO)NH

Instrument

Varian INOVA - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

16 3D HBHA(CO)NH

Instrument

Varian INOVA - 600 MHz at MU

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
2	sodium chloride	natural abundance	200 mM
3	MES	natural abundance	20 mM
4	calcium chloride	natural abundance	5 mM
5	DTT	natural abundance	10 mM
6	DSS	natural abundance	10 uM
7	sodium azide	natural abundance	0.02 %
8	H2O	natural abundance	90 %
9	D2O	natural abundance	10 %

17 4D CC-HMQC-NOESY-HMQC

Instrument

Varian INOVA - 600 MHz at MU

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 100% D2O

#	Name	Isotope labeling	Concentration
19	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
20	sodium chloride	natural abundance	200 mM
21	MES	natural abundance	20 mM
22	calcium chloride	natural abundance	5 mM
23	DTT	natural abundance	10 mM
24	DSS	natural abundance	10 uM
25	sodium azide	natural abundance	0.02 %
26	D2O	natural abundance	100 %

18 2D 1H-15N HSQC

Instrument

Varian INOVA - 600 MHz at MU

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 100% D2O

#	Name	Isotope labeling	Concentration
19	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
20	sodium chloride	natural abundance	200 mM
21	MES	natural abundance	20 mM
22	calcium chloride	natural abundance	5 mM
23	DTT	natural abundance	10 mM
24	DSS	natural abundance	10 uM
25	sodium azide	natural abundance	0.02 %
26	D2O	natural abundance	100 %

19 3D CCH-TOCSY

Instrument

Varian INOVA - 600 MHz at MU

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 100% D2O

#	Name	Isotope labeling	Concentration
19	HR6741A	[U-100% 13C; U-100% 15N]	0.7 mM
20	sodium chloride	natural abundance	200 mM
21	MES	natural abundance	20 mM
22	calcium chloride	natural abundance	5 mM
23	DTT	natural abundance	10 mM
24	DSS	natural abundance	10 uM
25	sodium azide	natural abundance	0.02 %
26	D2O	natural abundance	100 %

NMR combined restraints 5 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_18156_2lna.nef
Input source #2: Coordindates	2lna.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70--------80--------90---------
MGHHHHHHSHMKRSGREITWKDFVNNYLSKGVVDRLEVVNKRFVRVTFTPGKTPVDGQYVWFNIGSVDTFERNLETLQQELGIEGENRVPVVYIAESDG
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
MGHHHHHHSHMKRSGREITWKDFVNNYLSKGVVDRLEVVNKRFVRVTFTPGKTPVDGQYVWFNIGSVDTFERNLETLQQELGIEGENRVPVVYIAESDG

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	99	0	0	100.0

Content subtype: combined_18156_2lna.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1076		91.9 (chain: A, length: 99)
1	Distance restraints	CNS/XPLOR_distance_constraints_3	OK	1775 (1)	noe	89.9 (chain: A, length: 99)
2	Distance restraints	CNS/XPLOR_distance_constraints_2	OK	70 (1)	hbond	51.5 (chain: A, length: 99)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_4	OK	120 (120)	.	78.8 (chain: A, length: 99)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 99, Sequence coverage: 91.9%
- Total number of assignments
  - ¹H chemical shifts: 555
  - ¹³C chemical shifts: 420
  - ¹⁵N chemical shifts: 101
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
19	THR	HG1	5.17
25	ASN	CG	175.9
26	ASN	CG	176.8
40	ASN	CG	178.2
58	GLN	CD	180.2
63	ASN	CG	175.5
73	ASN	CG	175.8
78	GLN	CD	177.9
79	GLN	CD	180.2
87	ASN	CG	177.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	609	554	91.0
¹³C chemical shifts	458	411	89.7
¹⁵N chemical shifts	114	101	88.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	204	186	91.2
¹³C chemical shifts	198	177	89.4
¹⁵N chemical shifts	96	86	89.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	405	368	90.9
¹³C chemical shifts	260	234	90.0
¹⁵N chemical shifts	18	15	83.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	53	51	96.2
¹³C chemical shifts	53	51	96.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	63	48	76.2
¹³C chemical shifts	61	46	75.4
¹⁵N chemical shifts	2	2	100.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_3
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 99, Sequence coverage: 89.9%
- Total number of restraints: 1770
- Weight of restraints: 1.0 (1770)
- Potential type of restraints: square-well-parabolic (1770)
- Range of distance target values: 2.25, 3.9 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_2
  - Status: OK
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 99, Sequence coverage: 51.5%
  - Total number of restraints: 70
  - Weight of restraints: 1.0 (70)
  - Potential type of restraints: square-well-parabolic (70)
  - Range of distance target values: 2.0, 3.0 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_4
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 99, Sequence coverage: 78.8%
- Total number of restraints: 120
- Total number of restraints per polymer type: 120
- Weight of restraints: 1.0 (120)
- Potential type of restraints: square-well-parabolic (120)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords AFG3L2, AFG3-like gene 2, mitochondrial inner membrane protein, MPP, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), paraplegin-like, Protein NMR, Protein Structure Initiative, PSI-Biology, Structural Genomics, Target HR6741A

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (2.255 seconds)

BMRB: 18156

Sample #1

Sample #2

Sample #3

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. HR6741A, : 1 : 4 : 41 entities Detail

Interaction partners 1. HR6741A, : 47 interactors Detail

Experiments performed 19 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 5 contents Detail