Solution structure of Ca-bound S100A4 in complex with non-muscle myosin IIA
MACPLEKALD VMVSTFHKYS GKEGDKFKLN KSELKELLTR ELPSFLGKRT DEAAFQKLMS NLDSNRDNEV DFQEYCVFLS CIAMMCNEFF EGFPDKQPRK K
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 72.7 % (1225 of 1685) | 72.6 % (648 of 892) | 72.8 % (472 of 648) | 72.4 % (105 of 145) |
Backbone | 73.6 % (609 of 828) | 74.2 % (207 of 279) | 73.0 % (303 of 415) | 73.9 % (99 of 134) |
Sidechain | 71.2 % (706 of 992) | 71.0 % (435 of 613) | 72.0 % (265 of 368) | 54.5 % (6 of 11) |
Aromatic | 75.0 % (90 of 120) | 75.0 % (45 of 60) | 75.0 % (45 of 60) | |
Methyl | 70.0 % (84 of 120) | 70.0 % (42 of 60) | 70.0 % (42 of 60) |
1. entity 1
QRELEDATET ADAMNREVSS LKNKLRRGDL PFVVPRRMA2. entity 2
MACPLEKALD VMVSTFHKYS GKEGDKFKLN KSELKELLTR ELPSFLGKRT DEAAFQKLMS NLDSNRDNEV DFQEYCVFLS CIAMMCNEFF EGFPDKQPRK KSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.5 mM | |
2 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | CALCIUM ION | natural abundance | 5 mM | |
4 | MES | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 20 mM | |
6 | TCEP | natural abundance | 4 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 77.8 % (2621 of 3370) | 82.2 % (1466 of 1784) | 72.8 % (943 of 1296) | 73.1 % (212 of 290) |
Backbone | 77.1 % (1277 of 1656) | 84.8 % (473 of 558) | 72.9 % (605 of 830) | 74.3 % (199 of 268) |
Sidechain | 77.2 % (1531 of 1984) | 80.5 % (987 of 1226) | 72.1 % (531 of 736) | 59.1 % (13 of 22) |
Aromatic | 78.8 % (189 of 240) | 80.8 % (97 of 120) | 76.7 % (92 of 120) | |
Methyl | 77.9 % (187 of 240) | 85.0 % (102 of 120) | 70.8 % (85 of 120) |
1. entity 1
QRELEDATET ADAMNREVSS LKNKLRRGDL PFVVPRRMA2. entity 2
MACPLEKALD VMVSTFHKYS GKEGDKFKLN KSELKELLTR ELPSFLGKRT DEAAFQKLMS NLDSNRDNEV DFQEYCVFLS CIAMMCNEFF EGFPDKQPRK KSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.5 mM | |
2 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | CALCIUM ION | natural abundance | 5 mM | |
4 | MES | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 20 mM | |
6 | TCEP | natural abundance | 4 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.5 mM | |
2 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | CALCIUM ION | natural abundance | 5 mM | |
4 | MES | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 20 mM | |
6 | TCEP | natural abundance | 4 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.5 mM | |
2 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | CALCIUM ION | natural abundance | 5 mM | |
4 | MES | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 20 mM | |
6 | TCEP | natural abundance | 4 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.5 mM | |
2 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | CALCIUM ION | natural abundance | 5 mM | |
4 | MES | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 20 mM | |
6 | TCEP | natural abundance | 4 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.5 mM | |
2 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | CALCIUM ION | natural abundance | 5 mM | |
4 | MES | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 20 mM | |
6 | TCEP | natural abundance | 4 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.5 mM | |
2 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | CALCIUM ION | natural abundance | 5 mM | |
4 | MES | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 20 mM | |
6 | TCEP | natural abundance | 4 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.5 mM | |
2 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | CALCIUM ION | natural abundance | 5 mM | |
4 | MES | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 20 mM | |
6 | TCEP | natural abundance | 4 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.5 mM | |
2 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | CALCIUM ION | natural abundance | 5 mM | |
4 | MES | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 20 mM | |
6 | TCEP | natural abundance | 4 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.5 mM | |
2 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | CALCIUM ION | natural abundance | 5 mM | |
4 | MES | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 20 mM | |
6 | TCEP | natural abundance | 4 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.5 mM | |
2 | entity_2 | [U-100% 13C; U-100% 15N] | 1 mM | |
3 | CALCIUM ION | natural abundance | 5 mM | |
4 | MES | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 20 mM | |
6 | TCEP | natural abundance | 4 mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18169_2lnk.nef |
Input source #2: Coordindates | 2lnk.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------------------10--------20--------30--------40--------50--------60--------70--------80-------- MRGSHHHHHHGSMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRGSHHHHHHGSMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 90-------100- FFEGFPDKQPRKK ||||||||||||| FFEGFPDKQPRKK -------110---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
C | C | 39 | 0 | 0 | 100.0 |
A | A | 113 | 0 | 0 | 100.0 |
B | B | 113 | 0 | 0 | 100.0 |
Content subtype: combined_18169_2lnk.nef
Assigned chemical shifts
--------------------10--------20--------30--------40--------50--------60--------70--------80-------- MRGSHHHHHHGSMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .............ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE 90-------100- FFEGFPDKQPRKK ||||||||||||| FFEGFPDKQPRKK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
76 | CYS | HG | 3.272 |
81 | CYS | HG | 2.903 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 717 | 621 | 86.6 |
13C chemical shifts | 526 | 457 | 86.9 |
15N chemical shifts | 122 | 102 | 83.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 228 | 200 | 87.7 |
13C chemical shifts | 226 | 198 | 87.6 |
15N chemical shifts | 109 | 96 | 88.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 489 | 421 | 86.1 |
13C chemical shifts | 300 | 259 | 86.3 |
15N chemical shifts | 13 | 6 | 46.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 44 | 95.7 |
13C chemical shifts | 46 | 44 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 45 | 67.2 |
13C chemical shifts | 67 | 45 | 67.2 |
--------------------10--------20--------30--------40--------50--------60--------70--------80-------- MRGSHHHHHHGSMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .............ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE 90-------100- FFEGFPDKQPRKK ||||||||||||| FFEGFPDKQPRKK
---1900---1910------1920------1930----- QRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMA |||| ||||||||||||||||||||||||||||| ||| QREL.DATETADAMNREVSSLKNKLRRGDLPFVV..RMA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
81 | CYS | HG | 2.564 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 717 | 618 | 86.2 |
13C chemical shifts | 526 | 457 | 86.9 |
15N chemical shifts | 122 | 102 | 83.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 228 | 200 | 87.7 |
13C chemical shifts | 226 | 197 | 87.2 |
15N chemical shifts | 109 | 96 | 88.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 489 | 418 | 85.5 |
13C chemical shifts | 300 | 260 | 86.7 |
15N chemical shifts | 13 | 6 | 46.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 44 | 95.7 |
13C chemical shifts | 46 | 44 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 46 | 68.7 |
13C chemical shifts | 67 | 46 | 68.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 241 | 196 | 81.3 |
13C chemical shifts | 172 | 0 | 0.0 |
15N chemical shifts | 46 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 77 | 66 | 85.7 |
13C chemical shifts | 78 | 0 | 0.0 |
15N chemical shifts | 37 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 164 | 130 | 79.3 |
13C chemical shifts | 94 | 0 | 0.0 |
15N chemical shifts | 9 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 22 | 22 | 100.0 |
13C chemical shifts | 22 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 5 | 5 | 100.0 |
13C chemical shifts | 5 | 0 | 0.0 |
Distance restraints
--------------------10--------20--------30--------40--------50--------60--------70--------80-------- MRGSHHHHHHGSMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .............ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE 90-------100- FFEGFPDKQPRKK ||||||||||||| FFEGFPDKQPRKK
--------------------10--------20--------30--------40--------50--------60--------70--------80-------- MRGSHHHHHHGSMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .............ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE 90-------100- FFEGFPDKQPRKK ||||||||||||| FFEGFPDKQPRKK
---1900---1910------1920------1930----- QRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMA ||||||||||||||||||||||||||||||||||||||| QRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMA
Dihedral angle restraints
--------------------10--------20--------30--------40--------50--------60--------70--------80-------- MRGSHHHHHHGSMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE ||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..............CPLEKALDVMVSTFHKYSG..GDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE --------------------10--------20--------30--------40--------50--------60--------70--------80-------- 90-------100- FFEGFPDKQPRKK ||||| FFEGF 90---
--------------------10--------20--------30--------40--------50--------60--------70--------80-------- MRGSHHHHHHGSMACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE ||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ............MACPLEKALDVMVSTFHKYSG..GDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNE --------------------10--------20--------30--------40--------50--------60--------70--------80-------- 90-------100- FFEGFPDKQPRKK ||||| FFEGF 90---
---1900---1910------1920------1930----- QRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMA ||||||||||||||||||||||||||| |||||||| ..ELEDATETADAMNREVSSLKNKLRRGD..FVVPRRMA