Solution structure of atTic-hip/hop domain (Residue 310-371)
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.1 % (700 of 736) | 95.4 % (371 of 389) | 93.6 % (262 of 280) | 100.0 % (67 of 67) |
Backbone | 100.0 % (362 of 362) | 100.0 % (121 of 121) | 100.0 % (184 of 184) | 100.0 % (57 of 57) |
Sidechain | 91.7 % (398 of 434) | 93.3 % (250 of 268) | 88.5 % (138 of 156) | 100.0 % (10 of 10) |
Aromatic | 44.7 % (17 of 38) | 47.4 % (9 of 19) | 42.1 % (8 of 19) | |
Methyl | 100.0 % (54 of 54) | 100.0 % (27 of 27) | 100.0 % (27 of 27) |
1. entity
PEEVISKIME NPDVAMAFQN PRVQAALMEC SENPMNIMKY QNDKEVMDVF NKISQLFPGM TGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 5.56, Details 10% TFE was added to stable the structure
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | potassium phosphate | natural abundance | 20 mM | |
2 | sodium citrate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TFE | [U-99% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18171_2lnm.nef |
Input source #2: Coordindates | 2lnm.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60-- PEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFNKISQLFPGMTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFNKISQLFPGMTG
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 62 | 0 | 0 | 100.0 |
Content subtype: combined_18171_2lnm.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60-- PEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFNKISQLFPGMTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFNKISQLFPGMTG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 389 | 371 | 95.4 |
13C chemical shifts | 280 | 262 | 93.6 |
15N chemical shifts | 68 | 67 | 98.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 121 | 121 | 100.0 |
13C chemical shifts | 124 | 124 | 100.0 |
15N chemical shifts | 57 | 57 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 268 | 250 | 93.3 |
13C chemical shifts | 156 | 138 | 88.5 |
15N chemical shifts | 11 | 10 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 27 | 79.4 |
13C chemical shifts | 34 | 27 | 79.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 19 | 9 | 47.4 |
13C chemical shifts | 19 | 8 | 42.1 |
Distance restraints
--------10--------20--------30--------40--------50--------60-- PEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFNKISQLFPGMTG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PEEVISKIMENPDVAMAFQNPRVQAALMECSENPMNIMKYQNDKEVMDVFNKISQLFPGMTG