Solution structure of AGR2 residues 41-175
IDPFTPQTLS RGWGDQLIWT QTYEEALYKS KTSNKPLMII HHLDECPHSQ ALKKVFAENK EIQKLAEQFV LLNLVYETTD KHLSPDGQYV PRIMFVDPSL TVRADITGRY SNRLYAYEPA DTALLLDNMK KALKLLKTEL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 51.5 % (877 of 1704) | 28.5 % (253 of 888) | 72.8 % (488 of 670) | 93.2 % (136 of 146) |
Backbone | 80.9 % (667 of 824) | 50.4 % (139 of 276) | 96.2 % (400 of 416) | 97.0 % (128 of 132) |
Sidechain | 33.5 % (340 of 1016) | 18.6 % (114 of 612) | 55.9 % (218 of 390) | 57.1 % (8 of 14) |
Aromatic | 0.0 % (0 of 136) | 0.0 % (0 of 68) | 0.0 % (0 of 66) | 0.0 % (0 of 2) |
Methyl | 75.0 % (129 of 172) | 67.4 % (58 of 86) | 82.6 % (71 of 86) |
1. AGR2
IDPFTPQTLS RGWGDQLIWT QTYEEALYKS KTSNKPLMII HHLDECPHSQ ALKKVFAENK EIQKLAEQFV LLNLVYETTD KHLSPDGQYV PRIMFVDPSL TVRADITGRY SNRLYAYEPA DTALLLDNMK KALKLLKTELSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13C/15N/2H AGR2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | MES | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13CH3 ILV labelled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | MES | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 100 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | AGR2 | [U-15N] | 1 mM | |
12 | Pf1 phage | natural abundance | 10 mg | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % | |
15 | MES | natural abundance | 20 mM | |
16 | NaCl | natural abundance | 100 mM |
Solvent system PEG, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | AGR2 | [U-15N] | 1 mM | |
18 | PEG:Hexanol | natural abundance | 5 % | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % | |
21 | MES | natural abundance | 20 mM | |
22 | NaCl | natural abundance | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13C/15N/2H AGR2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | MES | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13CH3 ILV labelled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | MES | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13C/15N/2H AGR2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | MES | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13C/15N/2H AGR2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | MES | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13C/15N/2H AGR2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | MES | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13C/15N/2H AGR2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | MES | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13C/15N/2H AGR2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | MES | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13CH3 ILV labelled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | MES | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13CH3 ILV labelled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | MES | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13CH3 ILV labelled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % | |
9 | MES | natural abundance | 20 mM | |
10 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | AGR2 | [U-15N] | 1 mM | |
12 | Pf1 phage | natural abundance | 10 mg | |
13 | H2O | natural abundance | 90 % | |
14 | D2O | natural abundance | 10 % | |
15 | MES | natural abundance | 20 mM | |
16 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system PEG, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | AGR2 | [U-15N] | 1 mM | |
18 | PEG:Hexanol | natural abundance | 5 % | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % | |
21 | MES | natural abundance | 20 mM | |
22 | NaCl | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 13C/15N/2H AGR2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AGR2 | [U-13C; U-15N; U-2H] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | MES | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_18178_2lns.nef |
Input source #2: Coordindates | 2lns.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- IDPFTPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| IDPFTPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --140-------150-------160-------170----- TVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |||||||||||||||||||||||||||||||||||||||| TVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL -------110-------120-------130-------140
---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- IDPFTPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| IDPFTPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --140-------150-------160-------170----- TVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |||||||||||||||||||||||||||||||||||||||| TVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL -------110-------120-------130-------140
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 140 | 0 | 0 | 100.0 |
B | B | 140 | 0 | 0 | 100.0 |
Content subtype: combined_18178_2lns.nef
Assigned chemical shifts
---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- IDPFTPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....PQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSL --140-------150-------160-------170----- TVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |||||||||||||||||||||||||||||||||||||||| TVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
51 | GLN | CD | 180.949 |
69 | ASN | CG | 177.979 |
85 | GLN | CD | 180.67 |
103 | GLN | CD | 180.109 |
147 | ASN | CG | 178.076 |
163 | ASN | CG | 175.776 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 670 | 474 | 70.7 |
1H chemical shifts | 888 | 199 | 22.4 |
15N chemical shifts | 151 | 135 | 89.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 280 | 270 | 96.4 |
1H chemical shifts | 276 | 128 | 46.4 |
15N chemical shifts | 132 | 128 | 97.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 390 | 204 | 52.3 |
1H chemical shifts | 612 | 71 | 11.6 |
15N chemical shifts | 19 | 7 | 36.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 89 | 70 | 78.7 |
1H chemical shifts | 89 | 57 | 64.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 66 | 0 | 0.0 |
1H chemical shifts | 68 | 0 | 0.0 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- IDPFTPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSL ||||||||||||||||||||||||||||| | |||||||| ||||||||||||||||||||||||| ||||||||||| ||||| |||||| || ......QTLSRGWGDQLIWTQTYEEALYKSKTSNK.L.IIHHLDEC.HSQALKKVFAENKEIQKLAEQFVLL.LVYETTDKHLS.DGQYV.RIMFVD.SL ---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- --140-------150-------160-------170----- TVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |||||||||||||||||| |||||||||||||||||||| TVRADITGRYSNRLYAYE.ADTALLLDNMKKALKLLKTE --140-------150-------160-------170----
Dihedral angle restraints
---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- IDPFTPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSL ||||||||||| ||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||| ||| ||||||| .....PQTLSRGWGDQ.IWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAE.KEIQKLAEQFVLLNLVYETTDKHLSPDG.YVP..MFVDPSL ---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- --140-------150-------160-------170----- TVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |||||| ||||||||||||||||||||||||| TVRADI...YSNRLYAYEPADTALLLDNMKKALK --140-------150-------160---------
RDC restraints