BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	93.9 % (733 of 781)	97.0 % (394 of 406)	90.3 % (280 of 310)	90.8 % (59 of 65)
Backbone	92.4 % (375 of 406)	95.7 % (135 of 141)	90.6 % (183 of 202)	90.5 % (57 of 63)
Sidechain	96.1 % (420 of 437)	97.7 % (259 of 265)	93.5 % (159 of 170)	100.0 % (2 of 2)
Aromatic	86.7 % (52 of 60)	100.0 % (30 of 30)	73.3 % (22 of 30)
Methyl	98.7 % (75 of 76)	100.0 % (38 of 38)	97.4 % (37 of 38)

1. TtCdnLNt

AGHMKEFRPG DKVVLPPYGV GVVAGIAQRS VSGVSRAYYQ VDFPGSRSKA YVPVEAPHSV GLRKALAPEE

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
1	TtCdnLNt	natural abundance	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.05 %
5	DSS	natural abundance	0.5 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
8	TtCdnLNt	natural abundance	1 mM
9	sodium phosphate	natural abundance	50 mM
10	sodium chloride	natural abundance	100 mM
11	sodium azide	natural abundance	0.05 %
12	DSS	natural abundance	0.5 mM
13	D2O	natural abundance	100 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

Sample #4

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.5 mM
26	D2O	natural abundance	100 %

Chem. Shift Complete2

Sequence coverage: 80.0 %, Completeness: 59.0 %, Completeness (bb): 64.7 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	59.0 % (922 of 1562)	60.1 % (488 of 812)	51.1 % (317 of 620)	90.0 % (117 of 130)
Backbone	64.7 % (525 of 812)	71.3 % (201 of 282)	52.2 % (211 of 404)	89.7 % (113 of 126)
Sidechain	53.7 % (469 of 874)	54.2 % (287 of 530)	52.4 % (178 of 340)	100.0 % (4 of 4)
Aromatic	43.3 % (52 of 120)	50.0 % (30 of 60)	36.7 % (22 of 60)
Methyl	62.5 % (95 of 152)	63.2 % (48 of 76)	61.8 % (47 of 76)

1. TtCdnLNt

AGHMKEFRPG DKVVLPPYGV GVVAGIAQRS VSGVSRAYYQ VDFPGSRSKA YVPVEAPHSV GLRKALAPEE

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
1	TtCdnLNt	natural abundance	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.05 %
5	DSS	natural abundance	0.5 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
8	TtCdnLNt	natural abundance	1 mM
9	sodium phosphate	natural abundance	50 mM
10	sodium chloride	natural abundance	100 mM
11	sodium azide	natural abundance	0.05 %
12	DSS	natural abundance	0.5 mM
13	D2O	natural abundance	100 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

Sample #4

Solvent system 100% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.5 mM
26	D2O	natural abundance	100 %

Chem. Shift Complete3

Sequence coverage: 81.4 %, Completeness: 47.9 %, Completeness (bb): 55.5 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	47.9 % (1123 of 2343)	49.2 % (599 of 1218)	37.4 % (348 of 930)	90.3 % (176 of 195)
Backbone	55.5 % (676 of 1218)	64.3 % (272 of 423)	38.6 % (234 of 606)	89.9 % (170 of 189)
Sidechain	40.2 % (527 of 1311)	41.1 % (327 of 795)	38.0 % (194 of 510)	100.0 % (6 of 6)
Aromatic	34.4 % (62 of 180)	42.2 % (38 of 90)	26.7 % (24 of 90)
Methyl	46.5 % (106 of 228)	47.4 % (54 of 114)	45.6 % (52 of 114)

1. TtCdnLNt

AGHMKEFRPG DKVVLPPYGV GVVAGIAQRS VSGVSRAYYQ VDFPGSRSKA YVPVEAPHSV GLRKALAPEE

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
1	TtCdnLNt	natural abundance	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.05 %
5	DSS	natural abundance	0.5 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
8	TtCdnLNt	natural abundance	1 mM
9	sodium phosphate	natural abundance	50 mM
10	sodium chloride	natural abundance	100 mM
11	sodium azide	natural abundance	0.05 %
12	DSS	natural abundance	0.5 mM
13	D2O	natural abundance	100 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

Sample #4

Solvent system 100% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.5 mM
26	D2O	natural abundance	100 %

Protein Blocks Logo

Calculated from 20 models in PDB: 2LQK, Strand ID: A Detail

Release date

2012-07-29

Citation

NMR structure note: N-terminal domain of Thermus thermophilus CdnL
Gallego-Garcia, A., Mirassou, Y., Elias-Arnanz, M., Padmanabhan, S., Jimenez, A.
J. Biomol. NMR (2012), 53, 355-363, PubMed 22782235 , DOI 10.1007/s10858-012-9648-z , Abstract

Related entities 1. TtCdnLNt, : 1 : 4 : 15 entities Detail

Experiments performed 19 experiments Detail

1 2D 1H-1H COSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
1	TtCdnLNt	natural abundance	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.05 %
5	DSS	natural abundance	0.5 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

2 2D 1H-1H TOCSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
1	TtCdnLNt	natural abundance	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.05 %
5	DSS	natural abundance	0.5 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

3 2D 1H-1H NOESY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
1	TtCdnLNt	natural abundance	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	100 mM
4	sodium azide	natural abundance	0.05 %
5	DSS	natural abundance	0.5 mM
6	H2O	natural abundance	90 %
7	D2O	natural abundance	10 %

4 2D 1H-1H COSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
8	TtCdnLNt	natural abundance	1 mM
9	sodium phosphate	natural abundance	50 mM
10	sodium chloride	natural abundance	100 mM
11	sodium azide	natural abundance	0.05 %
12	DSS	natural abundance	0.5 mM
13	D2O	natural abundance	100 %

5 2D 1H-1H TOCSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
8	TtCdnLNt	natural abundance	1 mM
9	sodium phosphate	natural abundance	50 mM
10	sodium chloride	natural abundance	100 mM
11	sodium azide	natural abundance	0.05 %
12	DSS	natural abundance	0.5 mM
13	D2O	natural abundance	100 %

6 2D 1H-1H NOESY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
8	TtCdnLNt	natural abundance	1 mM
9	sodium phosphate	natural abundance	50 mM
10	sodium chloride	natural abundance	100 mM
11	sodium azide	natural abundance	0.05 %
12	DSS	natural abundance	0.5 mM
13	D2O	natural abundance	100 %

7 2D 1H-15N HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

8 3D HNCO

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

9 3D HNCA

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

10 3D CBCA(CO)NH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

11 3D HNCACB

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

12 3D HBHA(CO)NH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

13 3D HBHANH

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

14 2D 1H-13C HSQC aliphatic

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.5 mM
26	D2O	natural abundance	100 %

15 2D 1H-13C HSQC aromatic

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.5 mM
26	D2O	natural abundance	100 %

16 3D HCCH-TOCSY

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.5 mM
26	D2O	natural abundance	100 %

17 3D 1H-13C NOESY

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
21	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
22	sodium phosphate	natural abundance	50 mM
23	sodium chloride	natural abundance	100 mM
24	sodium azide	natural abundance	0.05 %
25	DSS	natural abundance	0.5 mM
26	D2O	natural abundance	100 %

18 2D 1H-15N HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 288 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

19 2D 1H-15N HSQC

Instrument

Bruker Avance - 800 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 (±0.1) K, pH 7.0 (±0.1)

#	Name	Isotope labeling	Concentration
14	TtCdnLNt	[U-100% 13C; U-100% 15N]	1 mM
15	sodium phosphate	natural abundance	50 mM
16	sodium chloride	natural abundance	100 mM
17	sodium azide	natural abundance	0.05 %
18	DSS	natural abundance	0.5 mM
19	H2O	natural abundance	90 %
20	D2O	natural abundance	10 %

NMR combined restraints 6 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_18193_2lqk.nef
Input source #2: Coordindates	2lqk.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50--------60--------70
AGHMKEFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEE
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
AGHMKEFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEE

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	70	0	0	100.0

Content subtype: combined_18193_2lqk.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	727		100.0 (chain: A, length: 70)
2	Assigned chemical shifts	assigned_chem_shift_list_2	Warning	118		80.0 (chain: A, length: 70)
3	Assigned chemical shifts	assigned_chem_shift_list_3	OK	112		75.7 (chain: A, length: 70)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	OK	1376 (1)	noe	94.3 (chain: A, length: 70)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_3	OK	109 (109)	.	95.7 (chain: A, length: 70)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 70, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 391
  - ¹³C chemical shifts: 278
  - ¹⁵N chemical shifts: 58
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A
Saveframe: assigned_chem_shift_list_2
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 70, Sequence coverage: 80.0%
- Total number of assignments
  - ¹H chemical shifts: 60
  - ¹⁵N chemical shifts: 58
- Completeness of assignments
  - Entity_assemble_ID: A
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A
Saveframe: assigned_chem_shift_list_3
- Status: OK
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 70, Sequence coverage: 75.7%
- Total number of assignments
  - ¹H chemical shifts: 57
  - ¹⁵N chemical shifts: 55
- Completeness of assignments
  - Entity_assemble_ID: A
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	406	391	96.3
¹³C chemical shifts	310	278	89.7
¹⁵N chemical shifts	70	58	82.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	141	134	95.0
¹³C chemical shifts	140	120	85.7
¹⁵N chemical shifts	63	56	88.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	265	257	97.0
¹³C chemical shifts	170	158	92.9
¹⁵N chemical shifts	7	2	28.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	39	39	100.0
¹³C chemical shifts	39	38	97.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	30	30	100.0
¹³C chemical shifts	30	22	73.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	406	60	14.8
¹⁵N chemical shifts	70	58	82.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	141	56	39.7
¹⁵N chemical shifts	63	56	88.9

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	265	4	1.5
¹⁵N chemical shifts	7	2	28.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	39	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	30	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	406	57	14.0
¹⁵N chemical shifts	70	55	78.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	141	53	37.6
¹⁵N chemical shifts	63	53	84.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	265	4	1.5
¹⁵N chemical shifts	7	2	28.6

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 70, Sequence coverage: 94.3%
- Total number of restraints: 1376
- Weight of restraints: 1.0 (1376)
- Potential type of restraints: upper-bound-parabolic (1376)
- Range of distance target values: 2.51, 5.5 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 70, Sequence coverage: 95.7%
- Total number of restraints: 109
- Total number of restraints per polymer type: 109
- Weight of restraints: 1.0 (109)
- Potential type of restraints: square-well-parabolic (109)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords CarD_TRCF, CdnL, PF02559, RNA polymerase interacting domain, Thermus thermophilus

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.672 seconds)

BMRB: 18193

Sample #1

Sample #2

Sample #3

Sample #4

Sample #1

Sample #2

Sample #3

Sample #4

Sample #1

Sample #2

Sample #3

Sample #4

Related entities 1. TtCdnLNt, : 1 : 4 : 15 entities Detail

Experiments performed 19 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 6 contents Detail