1H, 13C and 15N resonance assignments of the periplasmic signaling domain of HasR, a TonB-dependent outer membrane heme transporter
SMAQAAQQKN FNIAAQPLQS AMLRFAEQAG MQVFFDEVKL DGMQAAALNG SMSVEQGLRR LIGGNPVAFR LQPQGQIVLS RLPTANGDGG ALALDSLTVL GAGGNNA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.7 % (1054 of 1175) | 87.7 % (534 of 609) | 92.1 % (409 of 444) | 91.0 % (111 of 122) |
Backbone | 97.2 % (616 of 634) | 96.9 % (216 of 223) | 97.1 % (299 of 308) | 98.1 % (101 of 103) |
Sidechain | 83.6 % (531 of 635) | 82.4 % (318 of 386) | 88.3 % (203 of 230) | 52.6 % (10 of 19) |
Aromatic | 54.0 % (27 of 50) | 68.0 % (17 of 25) | 40.0 % (10 of 25) | |
Methyl | 96.0 % (121 of 126) | 96.8 % (61 of 63) | 95.2 % (60 of 63) |
1. HasR N-terminal periplasmic signaling domain
SMAQAAQQKN FNIAAQPLQS AMLRFAEQAG MQVFFDEVKL DGMQAAALNG SMSVEQGLRR LIGGNPVAFR LQPQGQIVLS RLPTANGDGG ALALDSLTVL GAGGNNASolvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HasR_N-terminal_periplasmic_signaling_domain | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | Sodium phosphate | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian NMR System - 600 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HasR_N-terminal_periplasmic_signaling_domain | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | Sodium phosphate | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Varian NMR System - 600 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HasR_N-terminal_periplasmic_signaling_domain | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | Sodium phosphate | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Varian NMR System - 600 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HasR_N-terminal_periplasmic_signaling_domain | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | Sodium phosphate | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Varian NMR System - 600 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HasR_N-terminal_periplasmic_signaling_domain | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | Sodium phosphate | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Varian NMR System - 600 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HasR_N-terminal_periplasmic_signaling_domain | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | Sodium phosphate | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Varian NMR System - 600 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HasR_N-terminal_periplasmic_signaling_domain | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | Sodium phosphate | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Varian NMR System - 600 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HasR_N-terminal_periplasmic_signaling_domain | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | Sodium phosphate | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Varian NMR System - 600 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HasR_N-terminal_periplasmic_signaling_domain | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | Sodium phosphate | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Varian NMR System - 600 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HasR_N-terminal_periplasmic_signaling_domain | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | Sodium phosphate | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Varian NMR System - 600 MHz
State isotropic, Solvent system 85% H2O/15% D2O, Pressure 1 atm, Temperature 293 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HasR_N-terminal_periplasmic_signaling_domain | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | Sodium phosphate | natural abundance | 50 mM | |
3 | NaCl | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18201_2m5j.nef |
Input source #2: Coordindates | 2m5j.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---10--------20--------30--------40--------50--------60--------70--------80--------90-------100----- SMAQAAQQKNFNIAAQPLQSAMLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSRLPTANGDGGALALDSLTVL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SMAQAAQQKNFNIAAQPLQSAMLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSRLPTANGDGGALALDSLTVL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --110-- GAGGNNA ||||||| GAGGNNA -------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 107 | 0 | 0 | 100.0 |
Content subtype: combined_18201_2m5j.nef
Assigned chemical shifts
---10--------20--------30--------40--------50--------60--------70--------80--------90-------100----- SMAQAAQQKNFNIAAQPLQSAMLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSRLPTANGDGGALALDSLTVL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .MAQAAQQKNFNIAAQPLQSAMLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSRLPTANGDGGALALDSLTVL --110-- GAGGNNA ||||||| GAGGNNA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
89 | THR | HG1 | 4.389 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 609 | 524 | 86.0 |
13C chemical shifts | 444 | 403 | 90.8 |
15N chemical shifts | 127 | 107 | 84.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 223 | 220 | 98.7 |
13C chemical shifts | 214 | 205 | 95.8 |
15N chemical shifts | 103 | 101 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 386 | 304 | 78.8 |
13C chemical shifts | 230 | 198 | 86.1 |
15N chemical shifts | 24 | 6 | 25.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 66 | 97.1 |
13C chemical shifts | 68 | 62 | 91.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 25 | 14 | 56.0 |
13C chemical shifts | 25 | 7 | 28.0 |
Distance restraints
---10--------20--------30--------40--------50--------60--------70--------80--------90-------100----- SMAQAAQQKNFNIAAQPLQSAMLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSRLPTANGDGGALALDSLTVL | |||||||||| || |||||||||||||||||||||||||| ||||||||||||||||||| |||||||||||||||||||| || |||||||||| .M.QAAQQKNFNI.AQ.LQSAMLRFAEQAGMQVFFDEVKLDGM.AAALNGSMSVEQGLRRLIG..PVAFRLQPQGQIVLSRLPTA..DG.ALALDSLTVL ---10--------20--------30--------40--------50--------60--------70--------80--------90-------100----- --110-- GAGGNNA | .....N --110-
Dihedral angle restraints
---10--------20--------30--------40--------50--------60--------70--------80--------90-------100----- SMAQAAQQKNFNIAAQPLQSAMLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSRLPTANGDGGALALDSLTVL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||| .MAQAAQQKNFNIAAQPLQSAMLRFAEQAGMQVFFDEVKLDGMQAAALNGSMSVEQGLRRLIGGNPVAFRLQPQGQIVLSRLPTANGDGGAL.LDSLTVL ---10--------20--------30--------40--------50--------60--------70--------80--------90-------100----- --110-- GAGGNNA |||| GAGG ----