NMR structure of an acyl-carrier protein from Rickettsia prowazekii.(Seattle Structural Genomics Center for Infectious Disease (SSGCID))
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.8 % (836 of 952) | 83.0 % (411 of 495) | 92.8 % (347 of 374) | 94.0 % (78 of 83) |
Backbone | 94.4 % (457 of 484) | 92.6 % (150 of 162) | 95.9 % (232 of 242) | 93.8 % (75 of 80) |
Sidechain | 83.2 % (456 of 548) | 78.4 % (261 of 333) | 90.6 % (192 of 212) | 100.0 % (3 of 3) |
Aromatic | 46.2 % (12 of 26) | 92.3 % (12 of 13) | 0.0 % (0 of 13) | |
Methyl | 97.2 % (105 of 108) | 96.3 % (52 of 54) | 98.1 % (53 of 54) |
1. acyl carrier protein
MSTTDKIEQK VIEMVAEKLN KDKAIITTDS RFIEDLKADS LDTVELMMAI EVEYGIDIPD DEATKIKTVS DVIKYIKERQ SSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein | [U-98% 13C; U-98% 15N] | 1.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein | [U-98% 13C; U-98% 15N] | 1.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein | [U-98% 13C; U-98% 15N] | 1.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein | [U-98% 13C; U-98% 15N] | 1.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein | [U-98% 13C; U-98% 15N] | 1.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein | [U-98% 13C; U-98% 15N] | 1.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein | [U-98% 13C; U-98% 15N] | 1.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein | [U-98% 13C; U-98% 15N] | 1.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein | [U-98% 13C; U-98% 15N] | 1.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein | [U-98% 13C; U-98% 15N] | 1.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | acyl carrier protein | [U-98% 13C; U-98% 15N] | 1.7 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18216_2lol.nef |
Input source #2: Coordindates | 2lol.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80- MSTTDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSTTDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 81 | 0 | 0 | 100.0 |
Content subtype: combined_18216_2lol.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80- MSTTDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...TDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
9 | GLN | CD | 178.124 |
20 | ASN | CG | 176.332 |
80 | GLN | CD | 178.241 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 495 | 405 | 81.8 |
13C chemical shifts | 374 | 347 | 92.8 |
15N chemical shifts | 85 | 78 | 91.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 162 | 154 | 95.1 |
13C chemical shifts | 162 | 155 | 95.7 |
15N chemical shifts | 80 | 75 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 333 | 251 | 75.4 |
13C chemical shifts | 212 | 192 | 90.6 |
15N chemical shifts | 5 | 3 | 60.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 54 | 93.1 |
13C chemical shifts | 58 | 56 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 13 | 12 | 92.3 |
13C chemical shifts | 13 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80- MSTTDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...TDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQS
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80- MSTTDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQS ||||||||||||||| ||||||| ||||||||||||| |||||||||| ||||| ||| ||| |||||||||||||||||| MSTTDKIEQKVIEMV.EKLNKDK.IITTDSRFIEDLK.DSLDTVELMM.IEVEY.IDI.DDE.TKIKTVSDVIKYIKERQS
--------10--------20--------30--------40--------50--------60--------70--------80- MSTTDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....DKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQ --------10--------20--------30--------40--------50--------60--------70--------80