Solution structure of AR55 in 50% HFIP
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.9 % (672 of 739) | 88.3 % (333 of 377) | 92.5 % (271 of 293) | 98.6 % (68 of 69) |
Backbone | 97.4 % (372 of 382) | 93.3 % (126 of 135) | 100.0 % (184 of 184) | 98.4 % (62 of 63) |
Sidechain | 86.2 % (356 of 413) | 85.5 % (207 of 242) | 86.7 % (143 of 165) | 100.0 % (6 of 6) |
Aromatic | 67.3 % (74 of 110) | 74.5 % (41 of 55) | 58.5 % (31 of 53) | 100.0 % (2 of 2) |
Methyl | 100.0 % (58 of 58) | 100.0 % (29 of 29) | 100.0 % (29 of 29) |
1. AR55
MEEGGDFDNY YGADNQSECE YTDWKSSGAL IPAIYMLVFL LGTTGNGLVL WTVFRKKGHH HHHHSolvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Bruker Avance III - 700 MHz IMB
State isotropic, Solvent system 50% Hexafluoroisopropanol/40% H2O /10% D2O, Temperature 310 K, Details AR55 in a 50% HFIP/50% water solution
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AR55 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | hexafluoroisopropanol | [U-99% 2H] | 50 % | |
3 | DSS | natural abundance | 1 mM | |
4 | DTT | [U-99% 2H] | 5 mM | |
5 | H2O | natural abundance | 40 % | |
6 | D2O | [U-99% 2H] | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18227_2low.nef |
Input source #2: Coordindates | 2low.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60---- MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 64 | 0 | 0 | 100.0 |
Content subtype: combined_18227_2low.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60---- MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
55 | ARG | HH21 | 6.434 |
55 | ARG | NH2 | 69.903 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 377 | 337 | 89.4 |
13C chemical shifts | 293 | 271 | 92.5 |
15N chemical shifts | 70 | 69 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 135 | 130 | 96.3 |
13C chemical shifts | 128 | 128 | 100.0 |
15N chemical shifts | 63 | 62 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 242 | 207 | 85.5 |
13C chemical shifts | 165 | 143 | 86.7 |
15N chemical shifts | 7 | 7 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 31 | 100.0 |
13C chemical shifts | 31 | 31 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 41 | 74.5 |
13C chemical shifts | 53 | 31 | 58.5 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60---- MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRKKGHHHHHH