BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	87.4 % (1249 of 1429)	85.9 % (652 of 759)	92.1 % (491 of 533)	77.4 % (106 of 137)
Backbone	95.8 % (644 of 672)	96.4 % (213 of 221)	95.4 % (329 of 345)	96.2 % (102 of 106)
Sidechain	81.1 % (707 of 872)	80.7 % (434 of 538)	89.1 % (270 of 303)	9.7 % (3 of 31)
Aromatic	43.2 % (32 of 74)	43.2 % (16 of 37)	45.7 % (16 of 35)	0.0 % (0 of 2)
Methyl	91.9 % (114 of 124)	91.9 % (57 of 62)	91.9 % (57 of 62)

1. entity 1

QRRQLTPQQQ QLVNQMKVAP IPKQLLQRIP NIPPNINTWQ QVTALAQQKL LTPQDMEAAK QVYKIHQQLL FKARLQQQQA Q

2. entity 2

STDSTPMFEY ENLEDNSKEW TSLFDNDIPV TTDD

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
1	Gal11	[U-15N]	1-1.2 mM
2	Gcn4	natural abundance	2-2.4 mM
3	Sodum phosphate	natural abundance	20 mM
4	Sodum chloride	natural abundance	150 mM
5	PMSF	natural abundance	1 mM
6	DTT	natural abundance	5 mM
7	H20	natural abundance	90 %
8	D2O	natural abundance	10 %

Sample #2

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
9	Gal11	natural abundance	2-2.4 mM
10	Gcn4	[U-15N]	1-1.2 mM
11	Sodum phosphate	natural abundance	20 mM
12	Sodum chloride	natural abundance	150 mM
13	PMSF	natural abundance	1 mM
14	DTT	natural abundance	5 mM
15	H20	natural abundance	90 %
16	D2O	natural abundance	10 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
17	Gal11	[U-13C; U-15N]	1-1.2 mM
18	Gcn4	natural abundance	2-2.4 mM
19	Sodum phosphate	natural abundance	20 mM
20	Sodum chloride	natural abundance	150 mM
21	PMSF	natural abundance	1 mM
22	DTT	natural abundance	5 mM
23	H20	natural abundance	90 %
24	D2O	natural abundance	10 %

Sample #4

Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
25	Gal11	[U-13C; U-15N]	1-1.2 mM
26	Gcn4	natural abundance	2-2.4 mM
27	Sodum phosphate	natural abundance	20 mM
28	Sodum chloride	natural abundance	150 mM
29	PMSF	natural abundance	1 mM
30	DTT	natural abundance	5 mM
31	D2O	natural abundance	100 %

Sample #5

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.12 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.12 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.06 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.21 ppm, Outliers: 2 Detail

Protein Blocks Logo

Calculated from 13 models in PDB: 2LPB, Strand ID: A, B Detail

Release date

2012-03-27

Citation

The acidic transcription activator Gcn4 binds the mediator subunit Gal11/Med15 using a simple protein interface forming a fuzzy complex
Brzovic, P.S., Heikaus, C.C., Kisselev, L., Vernon, R., Herbig, E., Pacheco, D., Warfield, L., Baker, D., Klevit, R.E., Hahn, S.
Mol. Cell (2011), 44, 942-953, PubMed 22195967 , DOI 10.1016/j.molcel.2011.11.008 , Abstract

Related entities 1. complex of the central activation doamin of Gcn4 bound to the mediator co-activator domain 1 of Gal11/med15, entity 1, : 1 : 2 : 4 entities Detail

Related entities 2. complex of the central activation doamin of Gcn4 bound to the mediator co-activator domain 1 of Gal11/med15, entity 2, : 1 : 2 : 1 entities Detail

Interaction partners 1. complex of the central activation doamin of Gcn4 bound to the mediator co-activator domain 1 of Gal11/med15, entity 1, : 37 interactors Detail

More details for 37 interactors identified by 9 citations

Interaction partners 2. complex of the central activation doamin of Gcn4 bound to the mediator co-activator domain 1 of Gal11/med15, entity 2, : 13 interactors Detail

More details for 13 interactors identified by 9 citations

Experiments performed 24 experiments Detail

1 2D 1H-15N HSQC

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
1	Gal11	[U-15N]	1-1.2 mM
2	Gcn4	natural abundance	2-2.4 mM
3	Sodum phosphate	natural abundance	20 mM
4	Sodum chloride	natural abundance	150 mM
5	PMSF	natural abundance	1 mM
6	DTT	natural abundance	5 mM
7	H20	natural abundance	90 %
8	D2O	natural abundance	10 %

2 2D 1H-15N HSQC

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
9	Gal11	natural abundance	2-2.4 mM
10	Gcn4	[U-15N]	1-1.2 mM
11	Sodum phosphate	natural abundance	20 mM
12	Sodum chloride	natural abundance	150 mM
13	PMSF	natural abundance	1 mM
14	DTT	natural abundance	5 mM
15	H20	natural abundance	90 %
16	D2O	natural abundance	10 %

3 3D CBCA(CO)NH

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
17	Gal11	[U-13C; U-15N]	1-1.2 mM
18	Gcn4	natural abundance	2-2.4 mM
19	Sodum phosphate	natural abundance	20 mM
20	Sodum chloride	natural abundance	150 mM
21	PMSF	natural abundance	1 mM
22	DTT	natural abundance	5 mM
23	H20	natural abundance	90 %
24	D2O	natural abundance	10 %

4 3D CBCA(CO)NH

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

5 3D HNCA

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
17	Gal11	[U-13C; U-15N]	1-1.2 mM
18	Gcn4	natural abundance	2-2.4 mM
19	Sodum phosphate	natural abundance	20 mM
20	Sodum chloride	natural abundance	150 mM
21	PMSF	natural abundance	1 mM
22	DTT	natural abundance	5 mM
23	H20	natural abundance	90 %
24	D2O	natural abundance	10 %

6 3D HNCA

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

7 3D HNCO

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
17	Gal11	[U-13C; U-15N]	1-1.2 mM
18	Gcn4	natural abundance	2-2.4 mM
19	Sodum phosphate	natural abundance	20 mM
20	Sodum chloride	natural abundance	150 mM
21	PMSF	natural abundance	1 mM
22	DTT	natural abundance	5 mM
23	H20	natural abundance	90 %
24	D2O	natural abundance	10 %

8 3D HNCO

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

9 3D HNCACB

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
17	Gal11	[U-13C; U-15N]	1-1.2 mM
18	Gcn4	natural abundance	2-2.4 mM
19	Sodum phosphate	natural abundance	20 mM
20	Sodum chloride	natural abundance	150 mM
21	PMSF	natural abundance	1 mM
22	DTT	natural abundance	5 mM
23	H20	natural abundance	90 %
24	D2O	natural abundance	10 %

10 3D HNCACB

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

11 3D 1H-15N NOESY

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
17	Gal11	[U-13C; U-15N]	1-1.2 mM
18	Gcn4	natural abundance	2-2.4 mM
19	Sodum phosphate	natural abundance	20 mM
20	Sodum chloride	natural abundance	150 mM
21	PMSF	natural abundance	1 mM
22	DTT	natural abundance	5 mM
23	H20	natural abundance	90 %
24	D2O	natural abundance	10 %

12 3D 1H-15N NOESY

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

13 3D 1H-13C NOESY aliphatic

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
25	Gal11	[U-13C; U-15N]	1-1.2 mM
26	Gcn4	natural abundance	2-2.4 mM
27	Sodum phosphate	natural abundance	20 mM
28	Sodum chloride	natural abundance	150 mM
29	PMSF	natural abundance	1 mM
30	DTT	natural abundance	5 mM
31	D2O	natural abundance	100 %

14 3D 1H-13C NOESY aliphatic

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

15 3D 1H-13C NOESY aromatic

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
25	Gal11	[U-13C; U-15N]	1-1.2 mM
26	Gcn4	natural abundance	2-2.4 mM
27	Sodum phosphate	natural abundance	20 mM
28	Sodum chloride	natural abundance	150 mM
29	PMSF	natural abundance	1 mM
30	DTT	natural abundance	5 mM
31	D2O	natural abundance	100 %

16 3D 1H-13C NOESY aromatic

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

17 3D C(CO)NH

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
17	Gal11	[U-13C; U-15N]	1-1.2 mM
18	Gcn4	natural abundance	2-2.4 mM
19	Sodum phosphate	natural abundance	20 mM
20	Sodum chloride	natural abundance	150 mM
21	PMSF	natural abundance	1 mM
22	DTT	natural abundance	5 mM
23	H20	natural abundance	90 %
24	D2O	natural abundance	10 %

18 3D C(CO)NH

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

19 3D H(CCO)NH

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
17	Gal11	[U-13C; U-15N]	1-1.2 mM
18	Gcn4	natural abundance	2-2.4 mM
19	Sodum phosphate	natural abundance	20 mM
20	Sodum chloride	natural abundance	150 mM
21	PMSF	natural abundance	1 mM
22	DTT	natural abundance	5 mM
23	H20	natural abundance	90 %
24	D2O	natural abundance	10 %

20 3D H(CCO)NH

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

21 2D 1H-13C HSQC aliphatic

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
17	Gal11	[U-13C; U-15N]	1-1.2 mM
18	Gcn4	natural abundance	2-2.4 mM
19	Sodum phosphate	natural abundance	20 mM
20	Sodum chloride	natural abundance	150 mM
21	PMSF	natural abundance	1 mM
22	DTT	natural abundance	5 mM
23	H20	natural abundance	90 %
24	D2O	natural abundance	10 %

22 2D 1H-13C HSQC aliphatic

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

23 2D 1H-13C HSQC aromatic

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
17	Gal11	[U-13C; U-15N]	1-1.2 mM
18	Gcn4	natural abundance	2-2.4 mM
19	Sodum phosphate	natural abundance	20 mM
20	Sodum chloride	natural abundance	150 mM
21	PMSF	natural abundance	1 mM
22	DTT	natural abundance	5 mM
23	H20	natural abundance	90 %
24	D2O	natural abundance	10 %

24 2D 1H-13C HSQC aromatic

Instrument

Varian INOVA - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5

#	Name	Isotope labeling	Concentration
32	Gal11	natural abundance	2-2.4 mM
33	Gcn4	[U-13C; U-15N]	1-1.2 mM
34	Sodum phosphate	natural abundance	20 mM
35	Sodum chloride	natural abundance	150 mM
36	PMSF	natural abundance	1 mM
37	DTT	natural abundance	5 mM
38	H20	natural abundance	90 %
39	D2O	natural abundance	10 %

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_18244_2lpb.nef
Input source #2: Coordindates	2lpb.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Error

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--160-----170-------180-------190-------200-------210-------220-------230--------
QRRQLTPQQQQLVNQMKVAPIPKQLLQRIPNIPPNINTWQQVTALAQQKLLTPQDMEAAKEVYKIHQQLLFKARLQQQQAQ
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
QRRQLTPQQQQLVNQMKVAPIPKQLLQRIPNIPPNINTWQQVTALAQQKLLTPQDMEAAKEVYKIHQQLLFKARLQQQQAQ
--------10--------20--------30--------40--------50--------60--------70--------80-

Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

-------110-------120-------130----
STDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDD
||||||||||||||||||||||||||||||||||
STDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDD
--------10--------20--------30----

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	81	0	0	100.0
B	B	34	0	0	100.0

Content subtype: combined_18244_2lpb.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Error	1228		97.5 (chain: A, length: 81), 97.1 (chain: B, length: 34)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	OK	825 (1)	noe	97.5 (chain: A, length: 81)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_4	OK	152 (152)	.	88.9 (chain: A, length: 81), 35.3 (chain: B, length: 34)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Error
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 81, Sequence coverage: 97.5%
  - Entity_assembly_ID: B, Chain length: 34, Sequence coverage: 97.1%
- Total number of assignments
  - ¹H chemical shifts: 639
  - ¹³C chemical shifts: 487
  - ¹⁵N chemical shifts: 102
- Completeness of assignments
  - Entity_assemble_ID: B
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A
  - Chain_ID: B

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	195	143	73.3
¹³C chemical shifts	150	119	79.3
¹⁵N chemical shifts	36	30	83.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	66	60	90.9
¹³C chemical shifts	68	63	92.6
¹⁵N chemical shifts	32	30	93.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	129	83	64.3
¹³C chemical shifts	82	56	68.3
¹⁵N chemical shifts	4	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	14	10	71.4
¹³C chemical shifts	14	10	71.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	20	0	0.0
¹³C chemical shifts	19	0	0.0
¹⁵N chemical shifts	1	0	0.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 81, Sequence coverage: 97.5%
- Total number of restraints: 825
- Weight of restraints: 1.0 (825)
- Potential type of restraints: square-well-parabolic (825)
- Range of distance target values: 2.59, 3.4 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
    None
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_4
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 81, Sequence coverage: 88.9%
  - Entity_assembly_ID: B, Chain length: 34, Sequence coverage: 35.3%
- Total number of restraints: 152
- Total number of restraints per polymer type: 152
- Weight of restraints: 1.0 (152)
- Potential type of restraints: square-well-parabolic (152)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords Activator, amino acid biosynthesis, Co-Activator, dna-binding, Gal11, Gcn4, MED15, Mediator, Nucleus, Phosphoprotein, Transcription, Transcription regulation

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (1.497 seconds)

BMRB: 18244

Sample #1

Sample #2

Sample #3

Sample #4

Sample #5

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. complex of the central activation doamin of Gcn4 bound to the mediator co-activator domain 1 of Gal11/med15, entity 1, : 1 : 2 : 4 entities Detail

Related entities 2. complex of the central activation doamin of Gcn4 bound to the mediator co-activator domain 1 of Gal11/med15, entity 2, : 1 : 2 : 1 entities Detail

Interaction partners 1. complex of the central activation doamin of Gcn4 bound to the mediator co-activator domain 1 of Gal11/med15, entity 1, : 37 interactors Detail

Interaction partners 2. complex of the central activation doamin of Gcn4 bound to the mediator co-activator domain 1 of Gal11/med15, entity 2, : 13 interactors Detail

Experiments performed 24 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument