Solution NMR Structure of syc0711_d from Synechococcus sp., Northeast Structural Genomics Consortium (NESG) Target SnR212
MGQGQNVLGQ DLEVCCCAPM TGWYRNGFCQ TDVQDRGSHT VCAEMTEEFL LFSRDRGNDL MTPRPEFNFP GLKAGDRWCL CASRWQEAFE AGMAPPVVLQ STEKSALRYV SLADLQAHAL PVLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.3 % (1170 of 1475) | 78.5 % (600 of 764) | 78.7 % (451 of 573) | 86.2 % (119 of 138) |
Backbone | 87.1 % (667 of 766) | 86.7 % (228 of 263) | 86.8 % (330 of 380) | 88.6 % (109 of 123) |
Sidechain | 73.6 % (610 of 829) | 74.3 % (372 of 501) | 72.8 % (228 of 313) | 66.7 % (10 of 15) |
Aromatic | 33.3 % (48 of 144) | 38.9 % (28 of 72) | 24.6 % (17 of 69) | 100.0 % (3 of 3) |
Methyl | 90.7 % (107 of 118) | 93.2 % (55 of 59) | 88.1 % (52 of 59) |
1. SnR212
MGQGQNVLGQ DLEVCCCAPM TGWYRNGFCQ TDVQDRGSHT VCAEMTEEFL LFSRDRGNDL MTPRPEFNFP GLKAGDRWCL CASRWQEAFE AGMAPPVVLQ STEKSALRYV SLADLQAHAL PVLEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.67 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.67 mM | |
12 | NaN3 | natural abundance | 0.02 % | |
13 | DTT | natural abundance | 10 mM | |
14 | CaCL2 | natural abundance | 5 mM | |
15 | NaCL | natural abundance | 100 mM | |
16 | Proteinase Inhibitors | natural abundance | 1 na | |
17 | MES pH 6.5 | natural abundance | 20 mM | |
18 | D2O | natural abundance | 10 % | |
19 | DSS | natural abundance | 50 uM | |
20 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.67 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.67 mM | |
12 | NaN3 | natural abundance | 0.02 % | |
13 | DTT | natural abundance | 10 mM | |
14 | CaCL2 | natural abundance | 5 mM | |
15 | NaCL | natural abundance | 100 mM | |
16 | Proteinase Inhibitors | natural abundance | 1 na | |
17 | MES pH 6.5 | natural abundance | 20 mM | |
18 | D2O | natural abundance | 10 % | |
19 | DSS | natural abundance | 50 uM | |
20 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.89 mM SnR212.015, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SnR212.015 | [U-100% 13C; U-100% 15N] | 0.89 mM | |
2 | NaN3 | natural abundance | 0.02 % | |
3 | DTT | natural abundance | 10 mM | |
4 | CaCL2 | natural abundance | 5 mM | |
5 | NaCL | natural abundance | 100 mM | |
6 | Proteinase Inhibitors | natural abundance | 1 na | |
7 | MES pH 6.5 | natural abundance | 20 mM | |
8 | D2O | natural abundance | 10 % | |
9 | DSS | natural abundance | 50 uM | |
10 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18290_2lq3.nef |
Input source #2: Coordindates | 2lq3.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGQGQNVLGQDLEVCCCAPMTGWYRNGFCQTDVQDRGSHTVCAEMTEEFLLFSRDRGNDLMTPRPEFNFPGLKAGDRWCLCASRWQEAFEAGMAPPVVLQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGQGQNVLGQDLEVCCCAPMTGWYRNGFCQTDVQDRGSHTVCAEMTEEFLLFSRDRGNDLMTPRPEFNFPGLKAGDRWCLCASRWQEAFEAGMAPPVVLQ -------110-------120-------130 STEKSALRYVSLADLQAHALPVLEHHHHHH |||||||||||||||||||||||||||||| STEKSALRYVSLADLQAHALPVLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 130 | 0 | 0 | 100.0 |
Content subtype: combined_18290_2lq3.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGQGQNVLGQDLEVCCCAPMTGWYRNGFCQTDVQDRGSHTVCAEMTEEFLLFSRDRGNDLMTPRPEFNFPGLKAGDRWCLCASRWQEAFEAGMAPPVVLQ ||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| ||||||| | ||||||||||||| ||||| .GQGQNVLGQDLEVCCCAPMTGWYRNGFCQTDVQDRGS.TVCAEMTEEFLLFSRDRGNDLMTPRPEFNFP.LKAGDRW.L.ASRWQEAFEAGMA.PVVLQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130 STEKSALRYVSLADLQAHALPVLEHHHHHH |||||||||||||||||||||||| STEKSALRYVSLADLQAHALPVLE -------110-------120----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 764 | 601 | 78.7 |
13C chemical shifts | 573 | 445 | 77.7 |
15N chemical shifts | 146 | 115 | 78.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 263 | 228 | 86.7 |
13C chemical shifts | 260 | 219 | 84.2 |
15N chemical shifts | 123 | 105 | 85.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 501 | 373 | 74.5 |
13C chemical shifts | 313 | 226 | 72.2 |
15N chemical shifts | 23 | 10 | 43.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 59 | 92.2 |
13C chemical shifts | 64 | 55 | 85.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 28 | 38.9 |
13C chemical shifts | 69 | 17 | 24.6 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGQGQNVLGQDLEVCCCAPMTGWYRNGFCQTDVQDRGSHTVCAEMTEEFLLFSRDRGNDLMTPRPEFNFPGLKAGDRWCLCASRWQEAFEAGMAPPVVLQ |||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| ||||||| | ||||||||||||| ||||| ..QGQNVLGQDLEVCCCAPMTGWYRNGFCQTDVQDRGS.TVCAEMTEEFLLFSRDRGNDLMTPRPEFNFP.LKAGDRW.L.ASRWQEAFEAGMA.PVVLQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130 STEKSALRYVSLADLQAHALPVLEHHHHHH |||||||||||||||||||||||| STEKSALRYVSLADLQAHALPVLE -------110-------120----
Dihedral angle restraints