NMR structure of the RNA binding motif 39 (RBM39) from Mus musculus
VQPLATQCFQ LSNMFNPQTE EEVGWDTEIK DDVIEECNKH GGVIHIYVDK NSAQGNVYVK CPSIAAAIAA VNALHGRWFA GKMITAAYVP LPTYHNLFPD SMTATQLLVP SRR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.1 % (1233 of 1297) | 94.2 % (628 of 667) | 95.1 % (484 of 509) | 100.0 % (121 of 121) |
Backbone | 98.0 % (651 of 664) | 98.7 % (222 of 225) | 97.0 % (323 of 333) | 100.0 % (106 of 106) |
Sidechain | 93.1 % (689 of 740) | 91.9 % (406 of 442) | 94.7 % (268 of 283) | 100.0 % (15 of 15) |
Aromatic | 85.7 % (96 of 112) | 87.5 % (49 of 56) | 83.3 % (45 of 54) | 100.0 % (2 of 2) |
Methyl | 97.0 % (130 of 134) | 97.0 % (65 of 67) | 97.0 % (65 of 67) |
1. entity
VQPLATQCFQ LSNMFNPQTE EEVGWDTEIK DDVIEECNKH GGVIHIYVDK NSAQGNVYVK CPSIAAAIAA VNALHGRWFA GKMITAAYVP LPTYHNLFPD SMTATQLLVP SRRSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBM39 | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | sodium azide | natural abundance | 4.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | na | indirect | 0.4048086 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBM39 | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | sodium azide | natural abundance | 4.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBM39 | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | sodium azide | natural abundance | 4.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBM39 | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | sodium azide | natural abundance | 4.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBM39 | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | sodium azide | natural abundance | 4.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBM39 | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | sodium azide | natural abundance | 4.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBM39 | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | sodium azide | natural abundance | 4.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBM39 | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | sodium azide | natural abundance | 4.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RBM39 | [U-95% 13C; U-95% 15N] | 1.2 mM | |
2 | sodium azide | natural abundance | 4.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18292_2lq5.nef |
Input source #2: Coordindates | 2lq5.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPD -------110--- SMTATQLLVPSRR ||||||||||||| SMTATQLLVPSRR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 113 | 0 | 0 | 100.0 |
Content subtype: combined_18292_2lq5.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .QPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPD -------110--- SMTATQLLVPSRR ||||||||||||| SMTATQLLVPSRR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 667 | 622 | 93.3 |
13C chemical shifts | 509 | 476 | 93.5 |
15N chemical shifts | 124 | 120 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 225 | 222 | 98.7 |
13C chemical shifts | 226 | 211 | 93.4 |
15N chemical shifts | 106 | 105 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 442 | 400 | 90.5 |
13C chemical shifts | 283 | 265 | 93.6 |
15N chemical shifts | 18 | 15 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 67 | 95.7 |
13C chemical shifts | 70 | 67 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 49 | 87.5 |
13C chemical shifts | 54 | 44 | 81.5 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .QPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPD -------110--- SMTATQLLVPSRR ||||||||||||| SMTATQLLVPSRR