Solution structure of the K60A mutant of Atox1
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.1 % (646 of 759) | 81.1 % (317 of 391) | 87.0 % (261 of 300) | 100.0 % (68 of 68) |
Backbone | 98.8 % (399 of 404) | 97.9 % (137 of 140) | 99.0 % (196 of 198) | 100.0 % (66 of 66) |
Sidechain | 74.1 % (309 of 417) | 71.7 % (180 of 251) | 77.4 % (127 of 164) | 100.0 % (2 of 2) |
Aromatic | 8.8 % (3 of 34) | 17.6 % (3 of 17) | 0.0 % (0 of 17) | |
Methyl | 85.4 % (70 of 82) | 85.4 % (35 of 41) | 85.4 % (35 of 41) |
1. entity
MPKHEFSVDM TCGGCAEAVS RVLNKLGGVK YDIDLPNKKV CIESEHSMDT LLATLKKTGA TVSYLGLESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | K60A | [U-100% 13C; U-100% 15N] | 0.4 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | K60A | [U-100% 15N] | 0.4 ~ 0.5 mM | |
7 | sodium phosphate | natural abundance | 100 mM | |
8 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | K60A | [U-100% 13C; U-100% 15N] | 0.4 ~ 0.5 mM | |
12 | sodium phosphate | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
14 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | K60A | [U-100% 15N] | 0.4 ~ 0.5 mM | |
7 | sodium phosphate | natural abundance | 100 mM | |
8 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | K60A | [U-100% 13C; U-100% 15N] | 0.4 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | K60A | [U-100% 13C; U-100% 15N] | 0.4 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | K60A | [U-100% 13C; U-100% 15N] | 0.4 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | K60A | [U-100% 13C; U-100% 15N] | 0.4 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | K60A | [U-100% 13C; U-100% 15N] | 0.4 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | K60A | [U-100% 13C; U-100% 15N] | 0.4 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | K60A | [U-100% 13C; U-100% 15N] | 0.4 ~ 0.5 mM | |
2 | sodium phosphate | natural abundance | 100 mM | |
3 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | K60A | [U-100% 15N] | 0.4 ~ 0.5 mM | |
7 | sodium phosphate | natural abundance | 100 mM | |
8 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | K60A | [U-100% 13C; U-100% 15N] | 0.4 ~ 0.5 mM | |
12 | sodium phosphate | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
14 | D2O | natural abundance | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | K60A | [U-100% 13C; U-100% 15N] | 0.4 ~ 0.5 mM | |
12 | sodium phosphate | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2.0 ~ 2.5 mM | |
14 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18299_2lq9.nef |
Input source #2: Coordindates | 2lq9.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60-------- MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 68 | 0 | 0 | 100.0 |
Content subtype: combined_18299_2lq9.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60-------- MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
4 | HIS | HD1 | 6.729 |
50 | THR | HG1 | 4.794 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 391 | 313 | 80.1 |
13C chemical shifts | 300 | 259 | 86.3 |
15N chemical shifts | 69 | 68 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 140 | 136 | 97.1 |
13C chemical shifts | 136 | 133 | 97.8 |
15N chemical shifts | 66 | 66 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 251 | 177 | 70.5 |
13C chemical shifts | 164 | 126 | 76.8 |
15N chemical shifts | 3 | 2 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 35 | 79.5 |
13C chemical shifts | 44 | 35 | 79.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 3 | 17.6 |
13C chemical shifts | 17 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60-------- MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE ||||||||| | ||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PKHEFSVDM.C.GCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60-------- MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGATVSYLGLE |||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||| MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEH..DTLLATLKKTGATVSYLGLE