NMR structure of the protein NP_390037.1 from Bacillus subtilis.
GAEALPLYYL QITGITSDGN DFAWDNLTSS QTKAPNVLKG NKLYVKARFM GYTKLTVITG KDGKNLLYNG TAKMFKSDAI LGQNKVVIGW DKYFEIPMDA LQDNSIQIKA LSSGTTFVYS QKIDFERE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.5 % (1357 of 1517) | 96.3 % (756 of 785) | 78.2 % (462 of 591) | 98.6 % (139 of 141) |
Backbone | 84.9 % (647 of 762) | 95.1 % (251 of 264) | 73.2 % (273 of 373) | 98.4 % (123 of 125) |
Sidechain | 94.8 % (827 of 872) | 96.9 % (505 of 521) | 91.3 % (306 of 335) | 100.0 % (16 of 16) |
Aromatic | 79.3 % (111 of 140) | 97.1 % (68 of 70) | 60.3 % (41 of 68) | 100.0 % (2 of 2) |
Methyl | 95.9 % (140 of 146) | 94.5 % (69 of 73) | 97.3 % (71 of 73) |
1. entity
GAEALPLYYL QITGITSDGN DFAWDNLTSS QTKAPNVLKG NKLYVKARFM GYTKLTVITG KDGKNLLYNG TAKMFKSDAI LGQNKVVIGW DKYFEIPMDA LQDNSIQIKA LSSGTTFVYS QKIDFERESolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390037.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | H2O | natural abundance | 95 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz mbavance601
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390037.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz mbavance601
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390037.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz mbavance601
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390037.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz mbavance800
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390037.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz mbavance800
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390037.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz mbavance800
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390037.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 600 MHz mbavance601
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NP_390037.1 | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 50 mM | |
5 | D2O | [U-99% 2H] | 5 % | |
6 | H2O | natural abundance | 95 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_18346_2lr4.nef |
Input source #2: Coordindates | 2lr4.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAEALPLYYLQITGITSDGNDFAWDNLTSSQTKAPNVLKGNKLYVKARFMGYTKLTVITGKDGKNLLYNGTAKMFKSDAILGQNKVVIGWDKYFEIPMDA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAEALPLYYLQITGITSDGNDFAWDNLTSSQTKAPNVLKGNKLYVKARFMGYTKLTVITGKDGKNLLYNGTAKMFKSDAILGQNKVVIGWDKYFEIPMDA -------110-------120-------- LQDNSIQIKALSSGTTFVYSQKIDFERE |||||||||||||||||||||||||||| LQDNSIQIKALSSGTTFVYSQKIDFERE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 128 | 0 | 0 | 100.0 |
Content subtype: combined_18346_2lr4.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAEALPLYYLQITGITSDGNDFAWDNLTSSQTKAPNVLKGNKLYVKARFMGYTKLTVITGKDGKNLLYNGTAKMFKSDAILGQNKVVIGWDKYFEIPMDA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AEALPLYYLQITGITSDGNDFAWDNLTSSQTKAPNVLKGNKLYVKARFMGYTKLTVITGKDGKNLLYNGTAKMFKSDAILGQNKVVIGWDKYFEIPMDA -------110-------120-------- LQDNSIQIKALSSGTTFVYSQKIDFERE |||||||||||||||||||||||||||| LQDNSIQIKALSSGTTFVYSQKIDFERE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 785 | 776 | 98.9 |
13C chemical shifts | 591 | 432 | 73.1 |
15N chemical shifts | 143 | 141 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 264 | 260 | 98.5 |
13C chemical shifts | 256 | 127 | 49.6 |
15N chemical shifts | 125 | 123 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 521 | 516 | 99.0 |
13C chemical shifts | 335 | 305 | 91.0 |
15N chemical shifts | 18 | 18 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 76 | 75 | 98.7 |
13C chemical shifts | 76 | 73 | 96.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 68 | 97.1 |
13C chemical shifts | 68 | 41 | 60.3 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAEALPLYYLQITGITSDGNDFAWDNLTSSQTKAPNVLKGNKLYVKARFMGYTKLTVITGKDGKNLLYNGTAKMFKSDAILGQNKVVIGWDKYFEIPMDA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AEALPLYYLQITGITSDGNDFAWDNLTSSQTKAPNVLKGNKLYVKARFMGYTKLTVITGKDGKNLLYNGTAKMFKSDAILGQNKVVIGWDKYFEIPMDA -------110-------120-------- LQDNSIQIKALSSGTTFVYSQKIDFERE |||||||||||||||||||||||||||| LQDNSIQIKALSSGTTFVYSQKIDFERE