NMR Structure of Signal Sequence Deleted (SSD) Rv0603 Protein from Mycobacterium tuberculosis without N-terminal His-tag
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.7 % (777 of 795) | 96.5 % (388 of 402) | 99.0 % (312 of 315) | 98.7 % (77 of 78) |
Backbone | 98.3 % (470 of 478) | 97.1 % (166 of 171) | 99.1 % (228 of 230) | 98.7 % (76 of 77) |
Sidechain | 97.4 % (375 of 385) | 96.1 % (222 of 231) | 99.3 % (152 of 153) | 100.0 % (1 of 1) |
Aromatic | 100.0 % (32 of 32) | 100.0 % (16 of 16) | 100.0 % (16 of 16) | |
Methyl | 98.9 % (91 of 92) | 97.8 % (45 of 46) | 100.0 % (46 of 46) |
1. Rv0603-SSD
GAMAFDGEDE VTGPDADRAR AAAVQAVPGG TAGEVETETG EGAAAYGVLV TRPDGTRVEV HLDRDFRVLD TEPADGDGGL ESolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 15N-Labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv0603-SSD | [U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | AEBSF protease inhibitor | natural abundance | 1 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | AEBSF protease inhibitor | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | AEBSF protease inhibitor | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 15N-Labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv0603-SSD | [U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | AEBSF protease inhibitor | natural abundance | 1 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | AEBSF protease inhibitor | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | AEBSF protease inhibitor | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | AEBSF protease inhibitor | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | AEBSF protease inhibitor | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | AEBSF protease inhibitor | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | AEBSF protease inhibitor | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | AEBSF protease inhibitor | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | AEBSF protease inhibitor | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | AEBSF protease inhibitor | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | AEBSF protease inhibitor | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | AEBSF protease inhibitor | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | AEBSF protease inhibitor | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 15N-Labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Rv0603-SSD | [U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | AEBSF protease inhibitor | natural abundance | 1 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | AEBSF protease inhibitor | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz NMR Facility for Macromolecules CSIR-CDRI Lucknow
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.01) K, pH 6.5 (±0.01), Details 13C-15N Doible labeled Rv0603-SSD
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | Rv0603-SSD | [U-99% 13C; U-99% 15N] | 1 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | AEBSF protease inhibitor | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18355_2lra.nef |
Input source #2: Coordindates | 2lra.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80- GAMAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGGLE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGGLE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 81 | 0 | 0 | 100.0 |
Content subtype: combined_18355_2lra.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80- GAMAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGGLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGGLE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 402 | 389 | 96.8 |
13C chemical shifts | 315 | 308 | 97.8 |
15N chemical shifts | 84 | 76 | 90.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 171 | 167 | 97.7 |
13C chemical shifts | 162 | 157 | 96.9 |
15N chemical shifts | 77 | 75 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 231 | 222 | 96.1 |
13C chemical shifts | 153 | 151 | 98.7 |
15N chemical shifts | 7 | 1 | 14.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 46 | 97.9 |
13C chemical shifts | 47 | 46 | 97.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 16 | 16 | 100.0 |
13C chemical shifts | 16 | 16 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80- GAMAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGGLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGGLE
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80- GAMAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGGLE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMAFDGEDEVTGPDADRARAAAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGGLE