NMR solution structure of staphyloxanthin biosynthesis protein
GSSISHSGNL YTAGQCTWYV YDKVGGEIGS TWGNANNWAA AAQGAGFTVN HTPSKGAILQ SSEGPFGHVA YVESVNSDGS VTISEMNYSG GPFSVSSRTI SASEAGNYNY IHI
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.1 % (1128 of 1186) | 96.2 % (575 of 598) | 93.5 % (433 of 463) | 96.0 % (120 of 125) |
Backbone | 95.7 % (643 of 672) | 95.4 % (228 of 239) | 96.0 % (310 of 323) | 95.5 % (105 of 110) |
Sidechain | 94.9 % (580 of 611) | 96.7 % (347 of 359) | 92.0 % (218 of 237) | 100.0 % (15 of 15) |
Aromatic | 84.8 % (117 of 138) | 92.8 % (64 of 69) | 75.8 % (50 of 66) | 100.0 % (3 of 3) |
Methyl | 97.1 % (101 of 104) | 96.2 % (50 of 52) | 98.1 % (51 of 52) |
1. entity
GSSISHSGNL YTAGQCTWYV YDKVGGEIGS TWGNANNWAA AAQGAGFTVN HTPSKGAILQ SSEGPFGHVA YVESVNSDGS VTISEMNYSG GPFSVSSRTI SASEAGNYNY IHISolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 137 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium phosphate | natural abundance | 2 mM | |
4 | sodium phosphate | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium chloride | natural abundance | 137 mM | |
9 | beta-mercaptoethanol | natural abundance | 5 mM | |
10 | sodium phosphate | natural abundance | 10 mM | |
11 | potassium phosphate | natural abundance | 2 mM | |
12 | D2O | natural abundance | 100 % | |
13 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 137 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium phosphate | natural abundance | 2 mM | |
4 | sodium phosphate | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 137 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium phosphate | natural abundance | 2 mM | |
4 | sodium phosphate | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 137 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium phosphate | natural abundance | 2 mM | |
4 | sodium phosphate | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 137 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium phosphate | natural abundance | 2 mM | |
4 | sodium phosphate | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 137 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium phosphate | natural abundance | 2 mM | |
4 | sodium phosphate | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 137 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium phosphate | natural abundance | 2 mM | |
4 | sodium phosphate | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 137 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium phosphate | natural abundance | 2 mM | |
4 | sodium phosphate | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 137 mM | |
2 | beta-mercaptoethanol | natural abundance | 5 mM | |
3 | potassium phosphate | natural abundance | 2 mM | |
4 | sodium phosphate | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium chloride | natural abundance | 137 mM | |
9 | beta-mercaptoethanol | natural abundance | 5 mM | |
10 | sodium phosphate | natural abundance | 10 mM | |
11 | potassium phosphate | natural abundance | 2 mM | |
12 | D2O | natural abundance | 100 % | |
13 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium chloride | natural abundance | 137 mM | |
9 | beta-mercaptoethanol | natural abundance | 5 mM | |
10 | sodium phosphate | natural abundance | 10 mM | |
11 | potassium phosphate | natural abundance | 2 mM | |
12 | D2O | natural abundance | 100 % | |
13 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium chloride | natural abundance | 137 mM | |
9 | beta-mercaptoethanol | natural abundance | 5 mM | |
10 | sodium phosphate | natural abundance | 10 mM | |
11 | potassium phosphate | natural abundance | 2 mM | |
12 | D2O | natural abundance | 100 % | |
13 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.1) K, pH 6.8 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | sodium chloride | natural abundance | 137 mM | |
9 | beta-mercaptoethanol | natural abundance | 5 mM | |
10 | sodium phosphate | natural abundance | 10 mM | |
11 | potassium phosphate | natural abundance | 2 mM | |
12 | D2O | natural abundance | 100 % | |
13 | staphyloxanthin_protein | natural abundance | 0.7 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18375_2lrj.nef |
Input source #2: Coordindates | 2lrj.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSSISHSGNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFGHVAYVESVNSDGSVTISEMNYSGGPFSVSSRTI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSSISHSGNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFGHVAYVESVNSDGSVTISEMNYSGGPFSVSSRTI -------110--- SASEAGNYNYIHI ||||||||||||| SASEAGNYNYIHI
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 113 | 0 | 0 | 100.0 |
Content subtype: combined_18375_2lrj.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSSISHSGNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFGHVAYVESVNSDGSVTISEMNYSGGPFSVSSRTI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..SISHSGNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFGHVAYVESVNSDGSVTISEMNYSGGPFSVSSRTI -------110--- SASEAGNYNYIHI ||||||||||||| SASEAGNYNYIHI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 598 | 577 | 96.5 |
13C chemical shifts | 463 | 433 | 93.5 |
15N chemical shifts | 126 | 119 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 239 | 229 | 95.8 |
13C chemical shifts | 226 | 215 | 95.1 |
15N chemical shifts | 110 | 104 | 94.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 359 | 348 | 96.9 |
13C chemical shifts | 237 | 218 | 92.0 |
15N chemical shifts | 16 | 15 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 52 | 98.1 |
13C chemical shifts | 53 | 52 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 64 | 92.8 |
13C chemical shifts | 66 | 50 | 75.8 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSSISHSGNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFGHVAYVESVNSDGSVTISEMNYSGGPFSVSSRTI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..SISHSGNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFGHVAYVESVNSDGSVTISEMNYSGGPFSVSSRTI -------110--- SASEAGNYNYIHI ||||||||||||| SASEAGNYNYIHI
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSSISHSGNLYTAGQCTWYVYDKVGGEIGSTWGNANNWAAAAQGAGFTVNHTPSKGAILQSSEGPFGHVAYVESVNSDGSVTISEMNYSGGPFSVSSRTI ||||||||||| ||||||||||||||| ||||| ||||||| ||||||||||| |||| ..............QCTWYVYDKVG........NANNWAAAAQGAGFT........AILQS......HVAYVES.NSDGSVTISEM..........SRTI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110--- SASEAGNYNYIHI |||||| |||| SASEAG..NYIH -------110--